SKU: 40992525259

FABP8 His Tag Protein, Human

Sale price$202.50 Regular price$225.00
Save 10%

Pay in installments of $56.25 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 27 - Sep 1

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

FABP8 His Tag Protein, HumanProduct Specification Species Human Synonyms Fatty acid binding protein 8, P2, PMP2 Accession P02689 Amino Acid Sequence Ser2 Val132, with N terminal 8*His MHHHHHHHHSNKFLGTWKLVSSENFDDYMKALGVGLATRKLGNLAKPTVIISKKGDIITIRTESTFKNTEISFKLGQEFEETTADNRKTKSIVTLQRGSLNQVQRWDGKETTIKRKLVNGKMVAECKMKGVVCTRIYEKV Expression System E. coli Molecular Weight 18kDa (Reducing) Purity 95% by SDS PAGE & RP HPLC Endotoxin <1EU g Conjugation Unconjugated Tag His Tag Physical

Product Specification


Species Human
Synonyms Fatty acid binding protein 8, P2, PMP2
Accession P02689
Amino Acid Sequence Ser2-Val132, with N-terminal 8*His MHHHHHHHHSNKFLGTWKLVSSENFDDYMKALGVGLATRKLGNLAKPTVIISKKGDIITIRTESTFKNTEISFKLGQEFEETTADNRKTKSIVTLQRGSLNQVQRWDGKETTIKRKLVNGKMVAECKMKGVVCTRIYEKV
Expression System E.coli
Molecular Weight 18kDa (Reducing)
Purity

>95% by SDS-PAGE & RP-HPLC

Endotoxin <1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer 20mM Tris, 100mM NaCl, pH8.0
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.

Background

FABP8 (fatty acid binding protein-8; also M [myelin]-FABP, P2 and PMP2) is also known as peripheral myelin protein 2, which is a cytosolic protein found primarily in peripheral nerves. PMP2 is a small, basic, and cytoplasmic lipid binding protein of peripheral myelin. Also, PMP2 may play a role in lipid transport protein in Schwann cells. Furthermore, PMP2 may bind cholesterol. PMP2 is a small, basic, and cytoplasmic lipid binding protein of peripheral myelin, which is a cytosolic protein found primarily in peripheral nerves.
Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 40992525259

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.9 ★★★★★
Based on 30 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
L
Verified Purchase
Liliana C Viloria V
Los Angeles, US
★★★★★ 5
Genial
Size: One Size, Color: (015) Tetra Gray / Gray Matter / White Quartz
Me encanta la textura y sobre todo que tiene para que siempre sepas en cuál pies va!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on August 29, 2025
M
Verified Purchase
m
Whiting, US
★★★★★ 5
Comfortable
Size: One Size, Color: (348) Silica Green / White / Titan Gray
Comfortable and stays in place
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 27, 2025
S
Verified Purchase
Sukoshi
West Palm Beach, US
★★★★★ 5
Best socks for work or working out.
Size: One Size, Color: (015) Tetra Gray / Gray Matter / White Quartz
Great socks. They stay on your heel! Love the material; breathable and not thick. Love the neutral tone colors.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 1, 2025
C
Verified Purchase
Cassandra Moxlow
Omaha, US
★★★★★ 3
Didn’t meet full expectations
Size: One Size, Color: (001) Black / Black / Jet Gray
Much shorter than anticipated.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 16, 2025
S
shannon oakley
Alexandria, US
★★★★★ 5
Great room divider
Color: Black, Size: 4 Panel-88'', Color: Black, Size: 4 Panel-88''
This is a room divider and would work great as one! I’m using it as a cover for my car port/garage so you can’t look in and see my messy garage as easily and for what I’m using it for it’s a little not quite as sturdy as I need it to but I’m sure it’s not meant to be used outside anyways so I don’t fault the product since I’m not using it as intended… with that said though…. It still covers my garage beautifully and really does exactly what a I need it to! I’m sure the wind may blow it over if it gets too crazy but I don’t see it breaking by any means. The frame is metal and drilled together using long screws. It’s very well built. The cloth for the panels is this waterproof type material that’s kind of like the gazebo roof feeling. So it’s easy to clean and it’s easy to wipe. You can put it straight or bend the panels and either way it still stands up. You don’t HAVE to bend it to make it stand or anything. You can literally use it straight across like I am in the pictures. Overall very happy with this product and it’s also very tall so it truly covers a lot (hides a lot lol). I’m 5’8 so you can see it’s taller than me by the pic I took
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 4, 2026

recommand products