SKU: 41691599076

Human CD1D Protein, His tag

Sale price$157.50 Regular price$175.00
Save 10%

Pay in installments of $43.75 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 26 - Aug 31

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human CD1D Protein, His tagProduct Specification Species Human Synonyms Antigen presenting glycoprotein CD1d, R3G1, CD1d Accession P15813 Amino Acid Sequence Protein sequence (P15813, Val21 Gly296, with C His tag)

Product Specification


Species Human
Synonyms Antigen-presenting glycoprotein CD1d, R3G1, CD1d
Accession P15813
Amino Acid Sequence

Protein sequence (P15813, Val21-Gly296, with C-His tag) VPQRLFPLRCLQISSFANSSWTRTDGLAWLGELQTHSWSNDSDTVRSLKPWSQGTFSDQQWETLQHIFRVYRSSFTRDVKEFAKMLRLSYPLELQVSAGCEVHPGNASNNFFHVAFQGKDILSFQGTSWEPTQEAPLWVNLAIQVLNQDKWTRETVQWLLNGTCPQFVSGLLESGKSELKKQVKPKAWLSRGPSPGPGRLLLVCHVSGFYPKPVWVKWMRGEQEQQGTQPGDILPNADETWYLRATLDVVAGEAAGLSCRVKHSSLEGQDIVLYWG

Expression System HEK293
Molecular Weight

Predicted MW: 33 kDa Observed MW: 43-55 kDa

Purity >90% by SDS-PAGE
Endotoxin <1EU/μg
Conjugation Unconjugated
Tag with C-His tag
Physical Appearance Lyophilized Powder
Storage Buffer

Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4 with 3% trehalose.

Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

CD1D is a non-classical MHC class I-like glycoprotein specializing in lipid antigen presentation to T cells, particularly natural killer T (NKT) cells. Unlike classical MHC molecules, it presents lipid and glycolipid antigens via a unique binding groove. Expressed on antigen-presenting cells, CD1D bridges innate and adaptive immunity by activating NKT cells to secrete cytokines, influencing responses to infections, autoimmunity, and cancer. Genetic variants are associated with diseases like type 1 diabetes.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 41691599076

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.8 ★★★★★
Based on 20 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
R
Verified Purchase
Ray
Whiting, US
★★★★★ 5
Great product and service after disappointment
Flavor Name: Traditional, Size: 4 Ounce (Pack of 1)
Ive tried a few different brands of biltong and made my own. I have to say that this wasn't my favorite. Believe me, i wanted to like it. The taste was sour and most of the bag was pulverized shreds. :( I did find that letting a bit airdry in a bowl made it a little more palatable, but honestly it'sjust sitting in my fridge still, where normally I'd have eaten the whole bag in a day or so. I will say that there was a decent amount for the price. The texture and cut were good on the whole pieces. Also, some of the bites left a weird coating and nasty taste on my tongue, like baking soda or something, but definitely an off taste. I had my own beef jerky store for several years, so I'm a connoisseur, but no snob. -----update 8/13/2019------- I contacted customer service via the email on the bag and got a response. They sent me a new bag and here is the email I sent them back. Very happy now. ....The biltong showed up last Thursday! I'm sorry i kept forgetting to email you. It is delicious. It's night and day difference between the bag I got through Amazon originally. This bag was pristine and the taste is spot on. Every piece is a perfect slice, no shreds or fluff. Dark, rich brown color, not hay colored like the old bag. I really think that the other bag got very hot or something and out the taste off. Thank you so much. Now I know that if I am in the mood for biltong, Ayoba-yo is a good choice. Thanks for the customer service as well.....
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on July 2, 2019
L
Verified Purchase
Louisa Hoffman
New York, US
★★★★★ 5
Ayoba-Yo Traditional Beef Biltong
Flavor Name: Traditional, Size: 4 Ounce (Pack of 1)
I have been lucky to visit South Africa a few times in my life. What is not lucky is coming home to the United States and craving biltong. Biltong is a magical, sugar-free, barely processed jerky and once you try it, you will never want to eat American beef jerky again. Biltong made in South Africa cannot be imported to the States, which is probably the saddest thing ever. I have searched for the perfect recreation of what I have eaten while road tripping through the Karoo, and I haven't found anything that can match it. Until I got this Ayoba-Yo Biltong delivered to my door yesterday. My search is over. Ayoba-Yo is a match to the biltong in my memories. The meat is sliced thin and perfect for snacking. It is fresh, doesn't contain any gross preservatives, and the flavors are the perfect traditional blend. Try this biltong and make the switch, you won't be disappointed!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 16, 2018
G
Verified Purchase
GonzoHST
Whiting, US
★★★★★ 4
Biltong, any brand, is healthier for you than “beef jerky”.
Flavor Name: Traditional, Size: 4 Ounce (Pack of 1)
Ayouba Biltong is soft and full of flavor without excess sugar, preservatives, and spices. Good quality: if you can get it on sale or with an Amazon subscription even better. Sometimes settling occurs and more small “shreds” of it than I’d like, but overall a great, good-tasting product. Per ounce? Hey no Biltong is “cheap”. This isn’t Jack’s Links, etc.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on July 6, 2024
L
Verified Purchase
Linna
Belleville, US
★★★★★ 3
Sour moist meat
Flavor Name: Traditional, Size: 4 Ounce (Pack of 1)
I had a hankering for jerky and found biltong instead. I didn’t know what made it different, but I was willing to try. I was very surprised how moist it was!! It’s better than the jerky here. If I wanted to gnaw on leather then I’d get my belt instead of paying money for dried meat. I liked that it didn’t have sugar. However , the flavor was confusing. It was mostly sour, like too much vinegar. Other reviewers mentioned that too and I must agree. I’m not sure how it’s suppose to taste but this experience makes me hesitate buying any more.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on October 22, 2020
C
Verified Purchase
Charles W. Ambrose
Grantham, US
★★★★★ 5
Great taste
Flavor Name: Traditional, Size: 4 Ounce (Pack of 1)
Great taste, the right size
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 25, 2026

recommand products