SKU: 42227630612

Human GFRAL Protein, His Tag

Sale price$63.00 Regular price$70.00
Save 10%

Pay in installments of $17.50 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 25 - Aug 30

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human GFRAL Protein, His TagProduct Specification Species Human Synonyms GFRAL, C6orf144 Accession Q6UXV0 Amino Acid Sequence Protein sequence (Q6UXV0, Ser19 Glu351, with C His Tag)

Product Specification


Species Human
Synonyms GFRAL, C6orf144
Accession Q6UXV0
Amino Acid Sequence

Protein sequence (Q6UXV0, Ser19-Glu351, with C-His Tag) SQTNNCTYLREQCLRDANGCKHAWRVMEDACNDSDPGDPCKMRNSSYCNLSIQYLVESNFQFKECLCTDDFYCTVNKLLGKKCINKSDNVKEDKFKWNLTTRSHHGFKGMWSCLEVAEACVGDVVCNAQLASYLKACSANGNPCDLKQCQAAIRFFYQNIPFNIAQMLAFCDCAQSDIPCQQSKEALHSKTCAVNMVPPPTCLSVIRSCQNDELCRRHYRTFQSKCWQRVTRKCHEDENCISTLSKQDLTCSGSDDCKAAYIDILGTVLQVQCTCRTITQSEESLCKIFQHMLHRKSCFNYPTLSNVKGMALYTRKHANKITLTGFHSPFNGE

Expression System HEK293
Molecular Weight Predicted MW: 39.5 kDa Observed MW: 35-45 kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Conjugation Unconjugated
Physical Appearance Lyophilized powder
Storage Buffer

Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4 with 3% trehalose.

Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

GFRAL is a receptor primarily expressed in the hindbrain and binds to the hormone GDF15. It plays a key role in metabolic regulation, mediating appetite suppression and body weight control in response to stress, inflammation, or disease. GFRAL activation triggers downstream signaling through the RET coreceptor, influencing energy homeostasis. Its association with GDF15 has made it a potential therapeutic target for obesity and metabolic disorders.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 42227630612

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.9 ★★★★★
Based on 13 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
M
Verified Purchase
Matthew D
New York, US
★★★★★ 5
Great multipurpose wall
Color: Black, Size: Upgraded Base-1 Panel, Color: Black, Size: Upgraded Base-1 Panel
Perfect for her to hide behind
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 5, 2026
K
Verified Purchase
Khrystal
Houston, US
★★★★★ 5
JAXPETY Room Divider Panel 6Ft Privacy Screen Wall Divider 88" W x 73" H - 3 Panel Black
Color: Black, Size: 3-Panel, Color: Black, Size: 3-Panel
I was looking for a screen to use while making video calls. I am on a budget, wanted something easy to put together, and would hide my apt in the background. Being on a budget, I thought my purchase qualified for the coupon. I was mistaken but contacted the seller. I received a quick response explaining how the coupon was applied. I was happy with the quick response and explanation which I verified when I went back to the page. The once all put together the screens are light weight and fairly easy to move. they do not seem to be made for easy daily breakdown. However, if you should need to take them apart to move or something, easy to break down. Depending on lighting will depend on if you find them transparent. I don't mind possible vague outlines; I was looking so no real details of my belongings in the background could be seen (shelves; figurines; etc.) My apt living room has no overhead light source, so floor lamps give light. In the 3 photos of 2 of the screens put together; the first is with a lamp in front and back of the screen as well as a tv on. The next has the tv off lamps still on and the screen reflecting the pc monitors. The third is with both lamps and the tv off, monitors on but not as reflective. In the box, you have all the parts you need as well as a small tool and an instruction manual. Item 'bags' are number [though they may come off in the box] to assist with assembly. Now assembly can be easy or hard depending on your abilities and the area you are working in. I have bad knees, so kneeling was not an option for me. My first attempt to put this together, I put the 'feet bases' on while still connecting the top bar. It made it twice as hard, and I stretched the fabric more than was necessary causing wholes around some of the stitching and stretching them a little. As well as causing some stitching to come undone on one of the pictured areas. Once I took off the 'feet bases', I had an easier time to screwing in the top bars. You will still need some hand strength, which I don't have much of, but it is possible. I use the grip things to open pickles jars. Once the screens were assembled, I followed the instructions of tying an outer screen to the inner screen and using the Velcro 'privacy flaps' to complete the connection. I have what I think is low shag carpeting which they were able to stand stably on once I wiggled them into standing straight up and in place. Given these post pandemic times, I am overall happy with both the divider and the price. The 2 things I do not like about the divider is the difficulty putting in the top bar [after connecting the top and sides] and storability when not in use issue I am having. Others with larger space will likely not have the last issue.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 19, 2025
W
Verified Purchase
WomanBehindTheMic
Louisville, US
★★★★★ 5
100% worth it - I recommend to EVERYONE
I've seen coworkers and instructors using folding screens behind them for video calls since the pandemic started, and I finally gave in and purchased this one. I freaking LOVE it. I love that I can be on a video call and not have to worry about the angle of my laptop or having people 'in' my home while I'm at work. It's so nice. I may eventually buy and deconstruct a wall hanging to create some colorful fabric panels instead of the brown, but (and I say this as NOT a brown fabric-lover) the brown looks pretty nice. It's a very dark brown, and it serves as completely neutral while still feeling a bit warm. - No need for tools to assemble, even though it says screwdriver. - One thing: I thought it would fold up flat, and it does NOT fold up flat. Important to know. I just keep it folded up into a 16.5" (grabbed a tape measure to check) square column by my desk and unfold whenever I have video conferences. If you can't tell, I really like having this thing around. 100% recommend and would buy again.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 24, 2021
R
Verified Purchase
riknik
Draper, US
★★★★★ 4
it's a utility screen
Color: Black, Size: 3-Panel
It's a basic, utilitarian screen. It's what I expected it to be. Assembly isn't hard, but it does require two people when stretching the fabric between the poles. I got it to use in a closet to separate the water heater from the washer/dryer, so it'll be perfect for that. Pros: it's opaque and tall (my 6'4" husband can't see over it unless he is standing against it) and I like the ability for the three pieces to stand separately of each other. Cons: it's flimsy. It wobbles and will tip over easily.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 9, 2022
J
Verified Purchase
Jane Gios
Belleville, US
★★★★★ 5
Great for the price
The item is great bit I wish it were a bit more sturdy and it folded flat. It folds into a square so it does take up some room when it's not in use.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 17, 2021

recommand products