SKU: 42383434713

Mouse VEGF-A Protein, His Tag

Sale price$117.00 Regular price$130.00
Save 10%

Pay in installments of $32.50 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 31 - Sep 5

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Mouse VEGF-A Protein, His TagProduct Specification Species Mouse Synonyms VEGF164, Vascular permeability factor (VPF), VEGF 1, VEGF164 Accession Q00731 2 Amino Acid Sequence Protein sequence (Q00731 2, Ala27 Arg190, with N His tag) APTTEGEQKSHEVIKFMDVYQRSYCRPIETLVDIFQEYPDEIEYIFKPSCVPLMRCAGCCNDEALECVPTSESNITMQIMRIKPHQSQHIGEMSFLQHSRCECRPKKDRTKPENHCEPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR Expression System HEK293 Molecular Weight Predicted MW: 21 kDa Observed MW: 25 30 kDa

Product Specification


Species Mouse
Synonyms VEGF164, Vascular permeability factor (VPF), VEGF-1, VEGF164
Accession Q00731-2
Amino Acid Sequence

Protein sequence (Q00731-2, Ala27-Arg190, with N-His tag) APTTEGEQKSHEVIKFMDVYQRSYCRPIETLVDIFQEYPDEIEYIFKPSCVPLMRCAGCCNDEALECVPTSESNITMQIMRIKPHQSQHIGEMSFLQHSRCECRPKKDRTKPENHCEPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR

Expression System HEK293
Molecular Weight Predicted MW: 21 kDa Observed MW: 25-30 kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Conjugation Unconjugated
Tag with N-His tag
Physical Appearance Lyophilized powder
Storage Buffer

Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4 with 3% trehalose.

Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

VEGFA is a key signaling protein that stimulates angiogenesis (blood vessel formation) and vascular permeability. Produced by various cell types, it binds to receptors VEGFR-1 and VEGFR-2, promoting endothelial cell proliferation, migration, and survival. Overexpressed in tumors, VEGFA supports cancer growth and metastasis by enhancing blood supply. It is a major target in anti-angiogenic cancer therapies, with drugs like bevacizumab (Avastin) blocking its activity. VEGFA also plays critical roles in wound healing and inflammatory diseases.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 42383434713

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.9 ★★★★★
Based on 9 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
E
Elle
Draper, US
★★★★★ 5
Very High-Quality Hedgehog Dog Toy That’s Bigger Than Expected
Style: Hedgehog
I am SO happy with this -- it's a nice surprise to get a dog toy that is this nice quality-wise! This plush toy is well-made and much larger than I thought it would be. The stitching is solid, and the material holds up to rough chewing. My dog’s been playing with it daily and it still looks good. The squeaker’s not too loud, and the soft texture makes it perfect for tugging or tossing.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 1, 2025
V
Vineyard Cow
Houston, US
★★★★★ 4
Very Soft Toy
Style: Hedgehog
This stuffed hedgehog is very soft and has a really nice squeaker in it. I can already tell that it will absolutely not hold up to an aggressive chewer, but it will be fun for a day or two for my pup. It would probably be way better as a giant toy for a tiny dog, but it was so cute that I couldn't resist for my husky mix.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 21, 2025
L
Verified Purchase
Lauren B. Smith
Houston, US
★★★★★ 5
One of my dog’s favorite toys.
This is one of my dog’s favorite toys. She loves figuring out how to pull the crinkly part out of the rubber tube, and she loves chewing on the spiky rubbery tube. I have to replace this toy often because my dog also likes to pull pieces of rubber off of the tube. She doesn’t ingest the rubber; she just loves the act of pulling it all apart. I am still giving this toy 5 stars because my dog loves this toy and it keeps her busy.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 17, 2026
A
Verified Purchase
Amazon Customer
Battle Creek, US
★★★★★ 2
Not a durable toy.
This only lasted a few minutes before it was destroyed by our dog. Not made well for chewing.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 12, 2026
D
Verified Purchase
D. K. Nichols
Fort Morgan, US
★★★★★ 1
not very sturdy for puppy chewer
The toy was large and it seemed to be made of good material, I was very excited to get this toy for my puppy, but the toy did not even last 24 hours. I was very disappointed. If you buy this product watch your puppy/ dog very carefully so they will not swallow any of the plastic or stuffing
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on November 8, 2024

recommand products