SKU: 4274347899

Human YWHAE/14-3-3 epsilon Protein, His Tag

Sale price$90.00 Regular price$100.00
Save 10%

Pay in installments of $25.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Sep 4 - Sep 9

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human YWHAE/14-3-3 epsilon Protein, His TagProduct Specification Species Human Synonyms 14 3 3 protein epsilon, 14 3 3E Accession P62258 Amino Acid Sequence Protein sequence (P62258, Met1 Gln255, with C His Tag) MDDREDLVYQAKLAEQAERYDEMVESMKKVAGMDVELTVEERNLLSVAYKNVIGARRASWRIISSIEQKEENKGGEDKLKMIREYRQMVETELKLICCDILDVLDKHLIPAANTGESKVFYYKMKGDYHRYLAEFATGNDRKEAAENSLVAYKAASDIAMTELPPTHPIRLGLALNFSVFYYEILNSPDRACRLAKAAFDDAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDMQGDGEEQNKEALQDVEDENQ Expression System E. coli

Product Specification


Species Human
Synonyms 14-3-3 protein epsilon, 14-3-3E
Accession P62258
Amino Acid Sequence

Protein sequence (P62258, Met1-Gln255, with C-His Tag) MDDREDLVYQAKLAEQAERYDEMVESMKKVAGMDVELTVEERNLLSVAYKNVIGARRASWRIISSIEQKEENKGGEDKLKMIREYRQMVETELKLICCDILDVLDKHLIPAANTGESKVFYYKMKGDYHRYLAEFATGNDRKEAAENSLVAYKAASDIAMTELPPTHPIRLGLALNFSVFYYEILNSPDRACRLAKAAFDDAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDMQGDGEEQNKEALQDVEDENQ

Expression System E.coli
Molecular Weight Predicted MW: 30.9 kDa Observed MW: 32 kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Conjugation Unconjugated
Physical Appearance Lyophilized powder
Storage Buffer

Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4 with 3% trehalose.

Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

YWHAE, also known as 14-3-3ε, is a member of the highly conserved 14-3-3 protein family. These proteins function as key regulatory molecules by binding to phosphorylated serine and threonine residues on a vast array of client proteins. Through these interactions, YWHAE modulates critical cellular processes including signal transduction, cell cycle control, apoptosis, and metabolism. It acts as a molecular scaffold, influencing the activity, localization, and stability of its binding partners. Its gene location within the 17p13.3 chromosomal region implicates it in human diseases; deletions encompassing YWHAE are associated with Miller-Dieker syndrome, a severe neuronal migration disorder, highlighting its essential role in brain development. YWHAE is dysregulated in various cancers, underscoring its importance in cellular proliferation and survival pathways.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 4274347899

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.8 ★★★★★
Based on 29 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
P
Verified Purchase
Precise Disarray
Fort Morgan, US
★★★★★ 5
super smooth, silky, stays comfortable feeling. DO NOT DRY or wash with heat
Color: Blue, Size: Queen (U.S. Standard), Set name: Stretchy and Soft, Color: Blue, Size: Queen (U.S. Standard), Set name: Stretchy and Soft
I'm impressed. I have used cooling pillow cases before, and found them effective, but the cooling material have always been on just one side. These are 100% cooling material. The material is super smooth and silky feeling. It is great feeling against hair and skin (even better than my old polyester satin I was using before cooling pillowcases). The material is cool, and does not seem to get hot hot. The pillow cases are super stretchy with a small hidden zipper. They grab onto the pillow and dont loosen up. Makes my pillow look neat and clean, not sloppy from loose material. I can even have two pillows stacked and somehow despite being a smooth material, the pillows dont just slide off each other. The cooling aspect works by not trapping heat, not allowing heat to get to the pillow and hold it there. So yeh, the pillow case will feel warm eventually but if you have a fan, or AC, or flip the pillow, then it is is truly cool. Otherwise in my experience when I use a pillow without this, the pillow just gets hot, stays hot, and even with flipping it feels hot.. because the pillow itself has trapped the heat for remainder of night. Yuck. One thing to know and this is very important-- as I learned the hard way-- DO NOT DRY IN DRYER. DO NOT WASH IN HOT WATER. Heat will destroy the material ability to feel and stay cool. Do you want a regular heat trapping pillow case? Then go ahead and dry these in the dryer a few times and you will have a regular pillow case. HOw do I know? I bought these to replace another set (different brand, same idea, same instructions that I failed to remember). I always dried them in the dryer, and one night after having gloriously cool pillows, I noticed that my pillow was HOT night after night. It was then when looking for another set of pillow cases that I learned that they cant be exposed to heat like that. SO PLEASE, just AIR DRY. And so, after I got these and put them on my pillows, I had a much better nights rest. I remember thinking that I wasnt waking to rearrange my pillows. They were just comfortable all night long. Sure, I'd love an even colder pillow, but our room is on the warm side. But at least I wasnt noting the hot hot pillows anymore.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 6, 2021
G
Verified Purchase
Grace
Boise, US
★★★★★ 5
A must try for hot sleepers!
Color: Blue, Size: Queen (U.S. Standard), Set name: Silky, Color: Blue, Size: Queen (U.S. Standard), Set name: Silky
If you are a hot sleeper these pillowcases are for you! Not only are they silky and beautiful, but they are cool to the touch!The Arc-Chill fabric absorbs heat and instantly cools your skin! If you are prone to insomnia, night sweats, give these a try! They come in a 2 pack and have a few different colors to try out. Highly recommend.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 27, 2026
A
Verified Purchase
Allen Plemmons
Massapequa, US
★★★★★ 5
Freezing !
Color: Gray, Size: Queen (U.S. Standard), Set name: Stretchy and Soft
### Product Review: Avolare 2 Pack Cooling Pillow Cases #### Overview The Avolare 2 Pack Cooling Pillow Cases are designed to provide a cooler and more comfortable sleeping experience, especially for hot sleepers. Made with Arc-Chill fabric, these pillowcases promise to offer a cooling effect, protect hair and skin, and add a touch of luxury with their soft and silky texture. The pillowcases come in a standard gray color, suitable for standard and queen-size pillows. #### Material and Design **Rating: ★★★★★** The Avolare Cooling Pillow Cases are crafted from Arc-Chill fabric, known for its high Q-max value (>0.5), indicating excellent cooling properties. The material feels incredibly soft and silky to the touch, providing a luxurious feel that enhances sleep quality. The gray color is neutral and versatile, fitting seamlessly with various bedding styles. The design includes a hidden zipper, ensuring that the pillowcase stays securely on the pillow while maintaining a smooth and sleek appearance. The zipper is discreet and doesn’t interfere with comfort, which is a thoughtful addition to the overall design. #### Cooling Effect **Rating: ★★★★★** One of the standout features of these pillowcases is their cooling effect. The Arc-Chill fabric effectively wicks away heat and moisture, making them ideal for hot sleepers or those living in warmer climates. Users have reported a noticeable difference in temperature, which contributes to a more restful and comfortable night’s sleep. This cooling property is particularly beneficial during the summer months or for individuals who tend to overheat while sleeping. #### Hair and Skin Benefits **Rating: ★★★★☆** In addition to their cooling properties, the Avolare pillowcases are also beneficial for hair and skin. The smooth and silky texture reduces friction, helping to prevent hair breakage and skin irritation. This can be particularly advantageous for individuals with sensitive skin or those prone to hair damage. While the pillowcases are not a cure-all for skin and hair issues, they do contribute positively by creating a gentler surface. #### Durability and Care **Rating: ★★★★☆** The Avolare Cooling Pillow Cases are easy to care for, maintaining their cooling properties and softness even after multiple washes. They are machine washable, which adds to their convenience. However, it is recommended to follow the care instructions carefully to ensure the longevity of the cooling effect and fabric quality. #### Versatility **Rating: ★★★★☆** These pillowcases are designed to fit both standard and queen-size pillows, adding to their versatility. They are perfect for use in any bedroom setting, from master bedrooms to guest rooms, and can be paired with various pillow types and fillings. #### Pros and Cons **Pros:** - Excellent cooling properties ideal for hot sleepers. - Soft and silky texture is gentle on hair and skin. - Hidden zipper design for a secure fit. - Machine washable and easy to care for. - Versatile fit for standard and queen-size pillows. **Cons:** - Cooling effect may diminish slightly with frequent washing. - Limited color options (only available in gray). #### Final Verdict **Overall Rating: ★★★★☆** The Avolare 2 Pack Cooling Pillow Cases are an excellent choice for anyone looking to enhance their sleeping experience, particularly hot sleepers. The cooling properties of the Arc-Chill fabric, combined with the soft and silky texture, provide a comfortable and luxurious feel. The hidden zipper design adds practicality without sacrificing aesthetics. While there are minor drawbacks, such as potential diminishing of the cooling effect with frequent washing and limited color options, the overall benefits make these pillowcases a worthwhile investment. If you’re seeking to improve your sleep quality and enjoy a cooler, more comfortable night’s rest, the Avolare Cooling Pillow Cases are definitely worth considering.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 1, 2024
B
Verified Purchase
Brian Olson
Alexandria, US
★★★★★ 4
Cool as the other side of the pillow
Color: Gray, Size: Queen (U.S. Standard), Set name: Stretchy and Soft
Good quality and keeps cool on side of pillow. Have to flip pillow for constant cooling is the ok only down side. Love the material as it is very soft and silky feel to it. Doesn't wrinkle over pillow and had some good color options. Easy to clean. Fair price for a good product
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 11, 2026
N
Verified Purchase
Nik
Birmingham, US
★★★★★ 5
Love!
Color: Blue, Size: Queen (U.S. Standard), Set name: Stretchy and Soft
Awesome cases! They really are cool to the touch. I didn’t sleep hot at all. I have a “cut-out” memory foam pillow, and this stretched around it perfectly. It is flexible enough that it doesn’t impede with the cut out. And while the material is “silky,” it doesn’t slide around the pillow while sleeping on it. The zipper feature is perfect. I washed and dried per the tag instructions and they washed very well. Super happy.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 8, 2026

recommand products