SKU: 43227985175

VSIG3/IGSF11 Fc Chimera Protein, Human

Sale price$259.20 Regular price$288.00
Save 10%

Pay in installments of $72.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 31 - Sep 5

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

VSIG3/IGSF11 Fc Chimera Protein, HumanProduct Specification Species Human Antigen VSIG3 IGSF11 Synonyms VSIG3, IgSF11, CXADRL1, Bt IgSF, CT119 Accession Q5DX21 1 Amino Acid Sequence Leu23 Gly241, with C terminal Human IgG1 Fc

Product Specification


Species Human
Antigen VSIG3/IGSF11
Synonyms VSIG3, IgSF11, CXADRL1, Bt-IgSF, CT119
Accession Q5DX21-1
Amino Acid Sequence

Leu23-Gly241, with C-terminal Human IgG1 Fc

LEVSESPGSIQVARGQPAVLPCTFTTSAALINLNVIWMVTPLSNANQPEQVILYQGGQMFDGAPRFHGRVGFTGTMPATNVSIFINNTQLSDTGTYQCLVNNLPDIGGRNIGVTGLTVLVPPSAPHCQIQGSQDIGSDVILLCSSEEGIPRPTYLWEKLDNTLKLPPTATQDQVQGTVTIRNISALSSGLYQCVASNAIGTSTCLLDLQVISPQPRNIGIEGRMDPKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

Expression System HEK293
Molecular Weight

55-70kDa (Reducing)

Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag Human Fc Tag
Physical Appearance Lyophilized Powder
Storage Buffer

PBS, pH7.4

Reconstitution

Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.

Stability & Storage

· 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.

· 3 months, -20 to -80℃ under sterile conditions after reconstitution.

· 1 week, 2 to 8℃ under sterile conditions after reconstitution.

· Please avoid repeated freeze-thaw cycles.

Reference

1. Suzu S, Hayashi Y, Harumi T, Nomaguchi K, Yamada M, Hayasawa H, et al. Molecular cloning of a novel immunoglobulin superfamily gene preferentially expressed by brain and testis. Biochem Biophys Res Commun (2002) 296(5):1215–21.

Background

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 43227985175

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.4 ★★★★★
Based on 30 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
J
Verified Purchase
JustAguy
West Palm Beach, US
★★★★★ 5
Great rv wheel chocks
Style: w/ Rope Design, Size: Pack of 2
After ten years, I finally decided to replace one pair of these. They have taken abuse through eleven camping seasons with my rv and I gave them to the new owner when selling my old trailer. I like these because I can use my orange plastic deadblow hammer to get them tight to the wheels. They are pointy so they really get under the tire and stay put. The rope handle makes them easy to pick up and move to the storage bay.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 24, 2025
B
Verified Purchase
Brother Gump
Battle Creek, US
★★★★★ 5
Excellent leveling blocks for our (heavy) Sprinter van
Size: 10.5' x 10.5", Color: Gray, Size: 10.5' x 10.5", Color: Gray
This review is for the FasTen XL 10 pack (10.5" × 10.5", 10 ea.). We have a 2024 AWD Sprinter van that's been fully converted to a Class B camper. Fully loaded, the van weighs ~ 8,650 lbs, and sits on 265-mm-wide (10.4-inches wide) BF Goodrich AT KO2 tires. The width of the tires were a driving factor in deciding to purchase the XL-sized blocks instead of the standard blocks. In addition, each wheel carries more than a ton of weight, especially in the rear. To be honest, I had my doubts about how well these plastic blocks would stand up to such loads. I am happy to report that after three weeks of daily use on both dirt and paved surfaces, these blocks have performed very well, showing no signs of cracking or deforming. While in use, the blocks sometimes appear to be bent (and possibly they are, but this could also be an illusion). Nonetheless, when stowing them, the blocks are perfectly flat and stack nicely for easy storage in the van's equipment box. Just knock off the dirt and pebbles, stack them up using the convenient handle, and you're ready to go.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on September 2, 2025
D
Verified Purchase
DeanoOutDoors
Battle Creek, US
★★★★★ 5
A Game-Changer for RVers - Camco Fasten XL 2x2 Leveling Block!
Size: 10.5' x 10.5", Color: Gray
As an avid RVer, I can't emphasize enough how the Camco Fasten XL 2x2 Leveling Block has transformed my RVing experience. These leveling blocks are an absolute game-changer, and here's why: Interlocking Design: The interlocking design is ingenious. It allows for effortless customization of the height needed to level my RV, no matter the terrain. These blocks securely fasten together, creating a solid foundation, and there's no need to worry about them shifting or slipping. Stability and Durability: These blocks are incredibly sturdy. They can handle the weight of my RV without flexing or cracking. Even on uneven surfaces, they provide a stable platform, ensuring my RV stays level and secure. Convenience: The Camco Fasten XL blocks are a breeze to use. I appreciate that they come with a built-in handle for easy transportation and storage. Setting them up is quick, saving me time and effort when I arrive at a new campsite. Versatility: They're not limited to leveling alone. I've also used them to support my RV's stabilizer jacks, making them versatile tools for various aspects of RV setup. Quality Build: These blocks are built to last. They can withstand the rigors of outdoor use and are resistant to UV damage. I'm confident that they'll serve me well for many RVing adventures to come. In summary, the Camco Fasten XL 2x2 Leveling Block is an absolute must-have for RVers. They make leveling and stabilizing an RV a breeze and offer peace of mind in any terrain. These blocks have significantly improved my camping experience, and I highly recommend them to fellow RV enthusiasts.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on November 7, 2023
S
Verified Purchase
Steve R. Pulley
San Leandro, US
★★★★★ 5
Excellent set of leveling blocks
Size: 8.5" x 8.5", Color: Yellow
These leveling blocks work very well for our Airstream interstate 19. They pack very compactly and seem to stay in place when we are upon them. I would recommend they be purchased if you need a set of leveling box
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 19, 2026
M
Verified Purchase
Marlenelam
Battle Creek, US
★★★★★ 5
Good block, nice package.
Size: 17" x 8.5", Color: Yellow
Decent device to level the RV.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 9, 2026

recommand products