SKU: 43630588562

Mouse CD83, his tag

Sale price$90.00 Regular price$100.00
Save 10%

Pay in installments of $25.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 30 - Sep 4

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Mouse CD83, his tagProduct Specification Species Mouse Accession O88324 Amino Acid Sequence Protein sequence (O88324, Met22 Arg133, with C 10*His) MREVTVACSETADLPCTAPWDPQLSYAVSWAKVSESGTESVELPESKQNSSFEAPRRRAYSLTIQNTTICSSGTYRCALQELGGQRNLSGTVVLKVTGCPKEATESTFRKYRGGGGSHHHHHHHHHH Expression System HEK293 Molecular Weight Predicted MW: 14. 0 kDa Observed MW: 23 40 kDa Purity 95% by SDS PAGE Tag with C 10*His Physical Appearance Lyophilized Powder Storage Buffer Lyophilized

Product Specification


Species Mouse
Accession O88324
Amino Acid Sequence

Protein sequence (O88324, Met22-Arg133, with C-10*His) MREVTVACSETADLPCTAPWDPQLSYAVSWAKVSESGTESVELPESKQNSSFEAPRRRAYSLTIQNTTICSSGTYRCALQELGGQRNLSGTVVLKVTGCPKEATESTFRKYRGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Predicted MW: 14.0 kDa Observed MW: 23-40 kDa
Purity >95% by SDS-PAGE
Tag with C-10*His
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

CD83 (Cluster of Differentiation 83) is a protein encoded by the CD83 gene. The transmembrane domain of membrane-bound CD83 stabilizes MHC II, costimulatory molecules and CD28 in the membrane by antagonizing MARCH-family E3 ubiquitin ligases. It is not clear what ligands interact with CD83, but membrane-bound CD83 may homotypically interact with the soluble form, suggesting autocrine immune regulation. However, it contrasts with differences between the single expression of soluble CD83 on monocytes and membrane-bound CD83 on activated dendritic cells seems also as their good marker. Soluble CD83 also binds to CD154, leading to T helper type 2 lymphocyte apoptosis by suppression of Bcl-2 inhibitors.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 43630588562

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.2 ★★★★★
Based on 13 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
D
Verified Purchase
Dennis Bruce
Massapequa, US
★★★★★ 5
Work great, easily adjustable and great for Celtic salt.
Size: 2 Count (Pack of 1)
I love these. They work fantastic and are easy to adjust. You can get mixed color pepper and I use Celtic salt in them. Great quality and come with the carrier.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 31, 2026
B
Verified Purchase
Blanca Cruz
Phoenix, US
★★★★★ 5
Good
Size: 2 Count (Pack of 1)
⭐⭐⭐⭐⭐ I really like this salt and pepper grinder. It works smoothly and is very easy to use. The grinding is even and consistent, and the material feels strong and well made. It has a nice design that looks great in the kitchen.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 16, 2026
P
Verified Purchase
Pupspicacious
Carnegie, US
★★★★★ 5
Good quality and great value
Size: 2 Count (Pack of 1)
Willow & Everett Salt and Pepper Grinder Set - Stainless Steel Manual Mills I bought this set because my smaller pepper grinder broke. This set is very similar in style, though larger. I really like it! The larger size is easier to handle and can store more pepper and salt inside it, meaning it needs less frequent refills. The adjustable grinder mechanisms work very well. The lids are easy to take on and off. The caddy is a little flimsy, but that wasn't why I bought the set. If you are swayed by the caddy, then you might be disappointed if it receives heavy use (like a family dinner table). But the mills and grinders themselves are good quality and a great bargain.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on November 30, 2024
G
Verified Purchase
GraphicsGuy
Los Angeles, US
★★★★★ 3
Simplicity wins here
Size: 2 Count (Pack of 1), Size: 2 Count (Pack of 1)
These S/P grinders are simple but I love it. I've purchased several grinders over the years. Some powered, a set using levers to grind, other manual twisters — each with cute features — that all had flaws with filling ease or the powered versions just quit working. This set is so easy to fill, adjust, and use, look, and feel great in hand, and don't break the bank with gimmicks. This set is form and function at its best. UPDATE: So I purchased this set in Nov of 2024. As you can see, it was love. Of late, the grinders have become problematic…especially the salt grinder. The salt grinder got to where even adjust the grind size because it took all I could do to even get the adjustment screw cap to screw on. Salt was getting trapped so I disassembled the grinder cap and cleaned it over and over. With each use, the grinder got more loose. Tonight, it finally gave up. No. These grinders aren’t extremely expensive but, from the reviews and ratings, I’m highly surprised and disappointed.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 17, 2025
E
Verified Purchase
Elangela castellanos
Massapequa, US
★★★★★ 5
Loved it!
Model: 2 Pack Salt and Pepper Grinder, Model: 2 Pack Salt and Pepper Grinder
I loved it! The grinders look very elegant and work perfectly. The size is great, they’re easy to use, and the grinding is smooth. They also feel sturdy and good quality. Definitely recommend!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 19, 2026

recommand products