SKU: 43836693497

Nucleocapsid CTD His Tag Protein, SARS-CoV-2

Sale price$324.00 Regular price$360.00
Save 10%

Pay in installments of $90.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Sep 1 - Sep 6

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Nucleocapsid CTD His Tag Protein, SARS-CoV-2Product Specification Species SARS CoV 2 Synonyms SARS CoV 2 coronavirus NP Protein; SARS CoV 2 np Protein; SARS CoV 2 novel coronavirus Nucleoprotein Protein Accession P0DTC9 Amino Acid Sequence MHHHHHHHHTKKSAAEASKKPRQKRTATKAYNVTQAFGRRGPEQTQGNFGDQELIRQGTDYKHWPQIAQFAPSASAFFGMSRIGMEVTPSGTWLTYTGAIKLDDKDPNFKDQVILLNKHIDAYKTFP. Expression System E. coli Molecular Weight 14. 5 kDa () Purity 95%, by SDS PAGE under reducing conditions Endotoxin <2EU g

Product Specification


Species SARS-CoV-2
Synonyms SARS-CoV-2 coronavirus NP Protein; SARS-CoV-2 np Protein; SARS-CoV-2 novel coronavirus Nucleoprotein Protein
Accession P0DTC9
Amino Acid Sequence MHHHHHHHHTKKSAAEASKKPRQKRTATKAYNVTQAFGRRGPEQTQGNFGDQELIRQGTDYKHWPQIAQFAPSASAFFGMSRIGMEVTPSGTWLTYTGAIKLDDKDPNFKDQVILLNKHIDAYKTFP.
Expression System E.coli
Molecular Weight 14.5 kDa (还原状态)
Purity >95%, by SDS-PAGE under reducing conditions
Endotoxin <2EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer 20mM PB, 100mM NaCl, pH7.4
Reconstitution Reconstitute at less than 1 mg/mL according to the size in ultrapure water after rapid centrifugation .
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.

Background

Nucleocapsid, nucleocapsid protein, is an important structural protein of novel coronavirus SARS-CoV-2, which is responsible for wrapping the virus RNA genome and then assembling virus particles. Nucleocapsid has two domains: NTD and CTD, in which CTD has two functions: binding to RNA genome and forming homodimer. There are many positively charged amino acid residues on the surface of CTD protein, which can bind to the negatively charged RNA genome by charge interaction. The two molecules of CTD can form a homodimer through the hydrophobic interaction between β-strands, and then form a higher-order polymer complex. Therefore, CTD plays an important role in the process of virus replication and assembly. In the process of novel coronavirus SARS-CoV-2 therapeutic drug development, CTD inhibitors have become a hot target for drug screening. At the same time, the antigen detection kit developed for CTD provides a more efficient and accurate detection method for SARS-CoV-2 detection.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 43836693497

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.2 ★★★★★
Based on 28 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
E
Verified Purchase
Eglantine
Carnegie, US
★★★★★ 5
Great taste
Flavor Name: Ceremony Matcha-1.06oz
Great quality matcha. It came with a cute little metal spoon. The color was bright green, just the way its supposed to be.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 17, 2026
J
Verified Purchase
joshua
Port Orchard, US
★★★★★ 5
Nice Matcha
Flavor Name: Ceremony Matcha-1.06oz
The flavor of this is very smooth and not bitter like some other matchas I’ve tried in the past. It’s very easy to incorporate into water and tastes amazing with soy milk and strawberry syrup. I’d say this is very fresh tasting and smelling. I did have consistent energy throughout the day with no crash which is a plus. Only warning is be very careful because the tin and product are very light I accidentally knocked it over the first day I had it and half the matcha fell onto the floor and was wasted. I’ve now learned to be very slow around it so I don’t drop it again.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 10, 2025
H
Verified Purchase
Howard Ki
Lake Worth, US
★★★★★ 4
REVIEW FROM A NON-BEGINNER HERE
Flavor Name: Ceremony Matcha-1.06oz, Flavor Name: Ceremony Matcha-1.06oz
I’ve been drinking matcha for years and I’m very particular with the quality and how I make it. I’ve tried many matchas, so I hope my review helps you. Would I buy again? - Yes. This matcha is great for someone who likes quality matcha without spending too much money. I would drink this as my daily matcha. - I can taste the difference between this matcha and a more expensive one, but I’d say this (price point aside) is about 90% in quality, taste, and experience if the expensive ones are 100%. Price: $12.59 after tax for 30g (bought on sale) Packaging: - Tin foil seal with pull tab, matcha loose in container, no bag inside of container - Comes with a rubber piece to keep matcha sealed after opening, very nice - Comes with a small metal spoon? - Top and bottom pieces separate from main container but don’t seem to have a function (see picture) Matcha: - In comparison to other high end matchas, this seems ever so slightly more coarse ground but doesn’t seem to have an effect on experience (no grainy feel) - the flavor has slightly less “matcha flavor” but for the price point, it exceeds my expectations, may just have to increase the ratio of matcha - Color: vibrant green, not dull oxidized color like some low end matchas - Mouth feel: Nice buttery and smooth - Caffeine: I am unfortunately not sensitive to caffeine so I can’t speak on the topic How I make my matcha lattes (so you can check my credentials or learn how to make as a beginner getting into matcha): 1. Heat water to 175°F/80°C, soak bamboo whisk for 5 minutes before using to soften the bristles 2. Two scoops of matcha (≈2g) with bamboo scoop (not provided with this product) into matcha bowl through a sieve (if you have one) 3. Slowly pour water into bowl, about 2oz/60ml 4. Use the whisk to gently swirl the matcha so that there is no dry powder left 5. Whisk vigorously in a “W” shape for 20 seconds (careful not to press the whisk into the bottom of bowl, it’s fragile) 6. Bring the whisk to the surface of the matcha and gently whisk in a “W” shape until the bubbles are broken up into smaller ones, aka “microfoam”, about 10 seconds 7. Finish up by swirling the matcha with the whisk in a gentle circle shape, leaving a small peak of foam in the middle as you pull the whisk from the surface. 8. (Optional) Combine with ice, milk (I use half and half, about 8oz), and sweetener to make a latte (add the sweetener after it’s in the glass so that you don’t expose sugar to the whisk) 9. Rinse matcha whisk and bowl with hot water, place whisk carefully back on holder, making sure not to snag any bristles For beginners: - Don’t use boiling water, it will burn the matcha and cause the flavor to suffer - BE SO GENTLE WITH THE WHISK PLEASE, and make sure you soak it before hand or it will be more prone to breakage - Get a whisk holder. The whisk will be prone to mold if stored upside down (bristles up) - When soaking the whisk, there should be a faint line about 1 cm down from the string binding, that’s where the water line should be. Don’t submerge the binding area or it will be more brittle and prone to mold. - A sieve is a worthwhile investment for a smooth matcha experience - All matchas naturally oxidize, so use within 1-3 months for a good experience, it’s not a feature of bad quality matcha, it’s just how all matcha is - Color matters. If it’s dull, that means it is old or bad quality, bright vibrant green is what you’re looking for - It’s normal for matcha to “settle” on the bottom of the glass after sitting for a while, just give it a swirl to remix it I wish you all luck on your matcha journey! If you’re a beginner, there’s a lot to learn, but it’s so worth it!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 16, 2026
S
Verified Purchase
Susan Chaffee-Sizemore
Port Orchard, US
★★★★★ 5
Really good matcha!
Flavor Name: Ceremony Matcha-1.06oz
Bright green and mild taste. One of my favorites
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 10, 2026
M
Verified Purchase
Mrs.Hira
San Leandro, US
★★★★★ 5
Amazing tasting ceremonial grade Matcha! Coming from a Matcha latte enthusiast!!!
Flavor Name: Ceremony Matcha-1.06oz, Flavor Name: Ceremony Matcha-1.06oz
This is one of the most amazing tasting Matcha powders I have ever purchased! I would definitely recommend this to anyone who loves Matcha lattes! It was very fresh and had a great taste. The price was reasonable for the amount. It’s cheaper than two large Matcha latte at any café. The color was also a nice very deep green color. The canister it comes in was very sturdy and did not break in travel. Overall, I highly recommend this ceremonial grade matcha!!!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 18, 2026

recommand products