Pay in installments of $67.50 with
,
and
Shipping Estimate
USA
- USA
- CAN
- USA
- CAN
Ships within 48 hours · Estimated delivery Jul 22 - Jul 27
Promo Codes Available:
For Your Every Summer RSVP, with Code: SUMMER15
Description
CD160 His Tag Protein, HumanProduct Specification Species Human Synonyms CD160, BY55, NK1, NK28 Accession O95971 Amino Acid Sequence Ile27 Ser159, with C terminal 8 * His INITSSASQEGTRLNLICTVWHKKEEAEGFVVFLCKDRSGDCSPETSLKQLRLKRDPGIDGVGEISSQLMFTISQVTPLHSGTYQCCARSQKSGIRLQGHFFSILFTETGNYTVTGLKQRQHLEFSHNEGTLSGGGSHHHHHHHH Expression System HEK293 Molecular Weight 23 27kDa Purity >95% by SDS PAGE Endotoxin <0. 1EU g Conjugation Unconjugated Tag His Tag Physical Appearance Lyophilized
Product Specification
| Species | Human |
| Synonyms | CD160, BY55, NK1, NK28 |
| Accession | O95971 |
| Amino Acid Sequence | Ile27-Ser159, with C-terminal 8 * His INITSSASQEGTRLNLICTVWHKKEEAEGFVVFLCKDRSGDCSPETSLKQLRLKRDPGIDGVGEISSQLMFTISQVTPLHSGTYQCCARSQKSGIRLQGHFFSILFTETGNYTVTGLKQRQHLEFSHNEGTLSGGGSHHHHHHHH |
| Expression System | HEK293 |
| Molecular Weight | 23-27kDa |
| Purity | >95% by SDS-PAGE |
| Endotoxin | <0.1EU/μg |
| Conjugation | Unconjugated |
| Tag | His Tag |
| Physical Appearance | Lyophilized Powder |
| Storage Buffer | PBS, pH7.4 |
| Reconstitution | Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation. |
| Stability & Storage | · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃. · 3 months, -20 to -80℃ under sterile conditions after reconstitution. · 1 week, 2 to 8℃ under sterile conditions after reconstitution. · Please avoid repeated freeze-thaw cycles. |
| Reference |
1、Barakonyi A. et al. (2004) Cutting edge: Engagement of CD160 by its HLA-c physiological ligand triggers a unique cytokine profile secretion in the cytotoxic peripheral blood NK cell subset. J Immunol. 173: 5349-5354. 2、He W. et al. (2019) Aberrant expressions of Co-stimulatory and Co-inhibitory molecules in autoimmune diseases. Front Immunol. 10: 261. 3、Zhang L. et al. (2020) CD160 plays a protective role during chronic infection by enhancing both functionalities and proliferative capacity of CD8+ T cells. Front Immunol. 11: 2188. |
Background
CD160 is expressed in NK cells, CD8+ T cells, TCRαβ+ and TCRγδ+ intraepithelial lymphocytes in the intestine, and skin resident CD4+ CD8αα+ cytotoxic T cells that stimulates effector function following engagement by its ligands. Engagement of CD160 recruits PI3K to activate the lytic cascade. CD160 is a promiscuous receptor that binds a variety of ligands including MHC class 1a and 1b molecules HLA-C, soluble HLA-G, HLA-A2, HLA-B7, and HLA-E, as well as the herpesvirus entry mediator protein. It plays a crucial role in the activation of NK-cell cytotoxicity and cytokine production. It also modulates the immune system and is involved in some pathologies, such as cancer. CD160 is also expressed by some subsets of T cells and activated endothelial cells, in which it regulates cell activation and apoptosis, respectively. Thus, CD160 is involved in antitumor immunity and protection during chronic infections. CD160 has been reported to be involved in the development of some pathologies, including autoimmune diseases, inflammatory diseases, atherosclerosis, retinal vascular diseases, chronic viral infections, and cancer.
Shipping Notes
- Free Standard Shipping on $100+ Orders to the USA.
- Except Preorder products are shipped in 48 hours.
- Delivery to the USA:
- Standard Shipping : 3-10 business days
- If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
- We offer a 30-day return/exchange service after receiving.
- Final sale items are not eligible for returns or exchanges.
- To process your return/exchange, please contact us at [email protected]
- Please click here for more details>>> Return & Exchange Policy