SKU: 45246562839

MUC-1(116-173) Fc Chimera Protein, Human

Sale price$252.00 Regular price$280.00
Save 10%

Pay in installments of $70.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 23 - Jul 28

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

MUC-1(116-173) Fc Chimera Protein, HumanProduct Specification Species Human Synonyms Mucin1, MUC1, CD227, EMA, H23AG, KL6, MAM6, MUC1, ZD, PEM, PEMT, PUM, CA15 3 Accession P15941 Amino Acid Sequence Ser116 Gly173, with C terminal Human IgG1 Fc

Product Specification


Species Human
Synonyms Mucin1, MUC1, CD227, EMA, H23AG, KL6, MAM6, MUC1, ZD, PEM, PEMT, PUM, CA15-3
Accession P15941
Amino Acid Sequence Ser116-Gly173, with C-terminal Human IgG1 Fc SVVVQLTLAFREGTINVHDVETQFNQYKTEAASRYNLTISDVSVSDVPFPFSAQSGAGIEGRMDPKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Expression System HEK293
Molecular Weight 36-42kDa
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag Human Fc Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1、Brayman M. et al. (2004) MUC1: a multifunctional cell surface component of reproductive tissue epithelia. Reprod Biol Endocrinol 2: 4.

2、Schroeder J A. et al. (2001) Transgenic MUC1 interacts with epidermal growth factor receptor and correlates with mitogen-activated protein kinase activation in the mouse mammary gland. J Biol Chem. 276(16): 13057-64.

3、Li Y. et al. (2001) The epidermal growth factor receptor regulates interaction of the human DF3/MUC1 carcinoma antigen with c-Src and beta-catenin. J Biol Chem. 276(38): 35239-42.

Background

Mucin 1, cell surface-associated (MUC1) or polymorphic epithelial mucin (PEM) is a membrane-bound protein that is a member of the mucin family. Mucins are heavily glycosylated proteins that give the mucosa viscous gel-forming properties, and contribute to the structural organization of secretory epithelia. The mucosa serves as a physical barrier to protect the epithelium from harsh environments such as low pH and microbial infections. Cell surface associated mucins, such as Mucin-1 (Muc-1), are important components of the mucosal barrier that exist at the interface of the apical surface between secreted mucins and the cell surface. In addition to the mucus-type functions of its extracellular mucin domain, Muc-1 is a transmembrane protein with a cytoplasmic tail that is a known target of multiple kinases that has been shown to participate in normal and oncogenic signaling.Muc-1 is overexpressed and aberrantly glycosylated in many cancers, where it has been documented to play an important role in inflammation and tumor progression.Muc-1 is also expressed on many non-epithelial cell types including leukocytes, where its function is less well characterized. It has been documented that Muc-1 controls inflammation resulting from Helicobacter pylori infection by suppressing activation of the NLRP3 inflammasome. Knockout of Muc-1 also results in aberrant expansion of myeloid derived suppressor cells from the bone marrow.
Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 45246562839

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.7 ★★★★★
Based on 17 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
G
Verified Purchase
Geoff Shepelew
Phoenix, US
★★★★★ 5
OUTSTANDING!!!
Style: AVR-X4800H, Style: AVR-X4800H
Alright folks. Grab a drink, sit down, and have a read. Because this is gonna be an eye full! This going to be an exhaustive, if not exhausting, full review of not only the Denon AVR-X4800H 9.4 receiver, but also all the speakers currently hooked up to it. Bottom Line Up Front (BLUF): Purchase this! You will decidedly not be disappointed. Allow me to explain... I recently upgraded from a Yamaha RX-V1900 receiver in a 7.1 configuration, to the current system of the Denon, in a 5.2.4 configuration. The former set consisted of the Yamaha receiver, a front pair of legacy Paradigm 3SE speakers (30 years old at publication), Paradigm 5.0 Cinema surround speakers, and a Paradigm 10" enclosed SE subwoofer. Big fan. It's now in my bedroom. My recent upgrade consists of: Denon AVR-X4800H, pair of Polk Audio (PA) Signature Elite ES60 towers (Front left and right), PA ES35 center channel, pair of PA ES20 surround speakers, pair of PA ES10 surround height speakers, pair of PA Reserve 900 front height speakers, a PA 12" HTS 12 subwoofer (bottom ported), and the aforementioned Paradigm 10" enclosed subwoofer. Crazy! Right?! Caveat: I am not an audiophile! But maybe I'm getting closer to one due to these purchases. I am not "brand" loyal. That is not to say that I've not had excellent experiences with prior brands. Big fan: of Pioneer and Yamaha receivers. Also had excellent experience with Paradigm speakers. I branched out this time, and it didn't disappoint. You know what you like best. Keep up with it! Or, try something new like I just did. RECEIVER: The Denon AVR-X4800H, is nothing short of exquisite. I had a bit of time on my hands while deployed overseas, and hours upon hours to research. It was a legitimate toss up between the AVR-3800H and the AVR-X4800H. Here's why. To be honest, there's not a heap of difference between them. The biggest being the 4800 pumps out 125 watts per 9 channels, whereas the 3800 puts out 105 watts. Yes, yes, I know that's not full RMS. Additional minor features are 3 trigger out ports, and it's made in Japan. I merely opted for more power, and glad that I did. That, and Amazon had this unit on mad sale - less than the MSRP of the 3800. So, why not? Pro tips: If you've gotten this far, you've already likely had several audio systems behind your belt, and more or less know the ropes when it comes to set up and so on. The set up wizard on this bad boy as easy AF. I personally recommend doing both the manual set up, and take accurate measurements from your optimum listening position (laser measurement tool is clutch here), AND doing the full Audyessy set up. Ultimately the Audysessy set up worked magnificently. Not only did it do a near perfect job calibrating every speaker, it also picked up on a couple of my set up mistakes (an out of phase speaker - which isn't hard considering the rats nest of wires to hook up, AND it discovered a lose wire connection). I made only the slightest tweaks to the Audyessy set up. The AVR has several audio processing options for both audio and visual listening options. Try them all out. You'll find out in short order what your preferences are. I am a particular fan of: Dolby Surround, Auro-3D, and Multi Channel options.The first two employ all your channels, the latter, everything but your subs - and you'd be surprised what sound you can achieve without your subs if you've the right speakers. Bluetooth: This system can both receive, and transmit, Bluetooth signal. Some comments on both. I employed a stand alone bluetooth receiver on my legacy AVR. Game changer. For this, it's absolutely fine to use. If you're familiar with receiving Bluetooth signal on your AVR, you'll know that the range is limited. Not terrible, but if you're sending signal from your phone from the bathroom or patios, you'll know that it can, and will, cut out until you're back in range. Just sayin'. Now, you can also transmit Bluetooth from the receiver, although not at the same time as receiving. You can transit up to 8 separate devices. This is where it can become potentially interesting. While I suspected the options I'm about to elaborate on, I did reach out to Denon for clarification on how and what I could transit to in terms on bluetooth capable devices. For what ever reason, the response was rather cagey, and I don't know why. So, check it out - you're already directly feeding what combination of speakers outputting from your AVR. Guess what! You can ALSO transit to a myriad of bluetooth capable speakers as well! 8, at minimum! Now, keep in mind, since your channel speakers are direct linked, your bluetooth receiving speakers will experience an ever so slight delay in reception. It can be annoying. You could of course set up your direct linked speakers on the same delay, and viola, match your bluetooth speakers. But here is where the transmitting bluetooth could REALLY count - MULTIROOM broadcasting! Why bother with the extra wires, when you can just as easily send signal to other rooms with bluetooth receiving speakers??? For example, I have 5 Alexas, the legacy AVR set up in 5.1, and another in the spare room with the same capability. So, having tested some of this theory, I've been able to broadcast sound to any bluetooth capable receiving speaker in the house. COOL!!! Right?! Wifi: I've never had the option of wifi on an AVR prior. Spoiler alert, another game changer. You can download, for free, some apps for this AVR. I suggest the Denon remote app, and also the HEOS app. You can perform basically every option with the remote app, as the actual remote. The remote is fine, but as usual, a rather unwieldy large wand. The remote app works great as well. As for HEOS, it's mostly great. Admittedly, the random option for your tunes, isn't exactly as random as you might prefer, That's ok, you can sub in what ever music you want, as you want, construct playlists, etc. If you subscribe to any music streaming music services you've that option as well. HDMI: The AVR supports 3 HDMI outputs, including eARC, and 7 in. At present I only have 2 inputs, my fire stick for streaming, and my Blu-ray. Output is direct to the TV. This does upscale up to 8k, to a capable monitor. I have a Samsung 85' behemoth TV. I don't personally notice an appreciable difference between the upscaling. But you might. Ok, ok, speaker set up. Finally. Polk Audio Signature Elite ES60 towers - front left and right. They. Are. Amazing. Truly. Way more bass capable than I expected. I can have my subs off, and barely notice the difference. Mine are the walnut wood tone, with the front grills off. I LOVE the contemporary look. Curved on the edges. Surprisingly deep, but not ridiculously so. 3 drivers and a tweeter. LOTS of sound. Bottom "power ported" design. Just gorgeous cabinetry. Center channel: Polk Audio Signature Elite ES35. This thing is crazy. It is probably the single greatest addition to the speaker combination. Not only does it fit perfectly beneath my television, looks amazing, but sounds absolutely incredible. Vocals and mid tones come through just brilliantly! Had I known just how profoundly amazing this speaker would have sounded, I'd have considered getting the biggest center channel I could afford. NO matter. It accomplishes everything I could possibly need, and then some. Front Height speakers: Polk Audio Reserve Series - R900. The single reason I opted to upgrade to the Reserve Series height speakers is simple. The Signature Elite height speakers are specifically made to rest atop the ES60 towers. Not that big of a deal. But. From my research it was expressly suggested to get your height speakers as far up to the ceiling as possible. The Signature Elite ES90s, being curved to the towers, can't be easily wall mounted. The R900s, can achieve both positions. So, have a look at my photos for the results. Zero complaints. Surround speakers: Polk Audio Signature Elite ES20s. I have these bad boys opposite each side of my couch, and central listening position. They could easily perform as your front channel speakers. Loads of bass, and clarity. They're essentially ES60 towers, but a third the size and volume. These things just ring next to my ears! I have heard sounds and tones from songs I've listened to for decades; but never heard before. Phenomenal! Surround height speakers: Polk Audio Signature Elite ES10s. I got these as gifts prior to purchasing the new AVR, and additional speakers. I originally had them set up as a mid room surround speaker pair. BAD idea! They seriously underperformed there. Like, bad. Useless really. Now, I have them set up atop corner photo stands. See pics. Now, I don't have them as high up as maybe they should be, BUT, they sound exactly as I was hoping. Very very good height sound. I bought rubber computer desk angled stands, reversed them they way they were meant to be mounted, so now the speakers are oriented downwards towards my dome piece. And voila again! A very happy accident, in the immortal words of Bob Ross. I'm not joking when I say this configuration worked even better than I had hoped. Subs!: Since I had the option, I chose to make it a left and right Sub configuration. Again, you've the option to wire up to 4 subs with the Denon AVR 4800! Insane. I chose a front left and right configuration because I share the rear wall with neighbors. I know, first world problems. Call me considerate. Anywho. I have the legacy 10" downward facing Paradigm SE sub on the right. For its small size, it can sing ridiculously loud, and deep. For the left sub I have the front facing Polk Audio HTS 12' (discontinued). I considered the actual Signature Elite ES12, but the HTS just so happened to aesthetically match the rest of the existing speakers, particularly in terms of the downward facing power port. Again, no complaints. The truth of the matter is this: Considering the wealth of orgasmic audio bliss achieved by this truly magnificent set up, I've barely put it through its paces. Don't get me wrong, I've spent hours hypnotized by the otherworldly sound this AVR and speakers produce. What's really cool, is even at low levels, you can still achieve the same incredible sound processing. I'm floored. A couple final thoughts: Cable management. DO IT!!! I know you've already spent hours upon hours, shopping, researching, unboxing, etc. Take the time to set up your audio system, right, and the first time. You'll kick yourself repeatedly if you don't. I spent less than $40 on rectangular speaker wire conduit, measured a dozen times, cut a couple few times, and mounted it along the walls, floors, and fireplace. Looks amazing, if I might say. With any luck, you'll never have to reaccomplish the task again until you move to the next pad. Also, do take the time to read through the massively long user AVR manual. I learned, a LOT! Know what your gear is capable of. There is more science built into this thing that the CERN collider. You'll be grateful that you did. Ok, time for a refill, yes? Thanks for taking the time to read through. Hope this helped!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 25, 2025
J
Verified Purchase
Just a Customer
Grantham, US
★★★★★ 5
super - amazing - but not perfect - Denon AVR-X1800H 7.2 Channel AV Receiver
Style: AVR-X1800H
super - amazing - but not perfect - Denon AVR-X1800H 7.2 Channel AV Receiver - 80W/Channel, Wireless Streaming via Built-in HEOS, WiFi, & Bluetooth, Supports Dolby Vision, HDR10+, Dynamic HDR, and Home Automation Systems - There are many aspects of the Denon AVR-X1800H Receiver that are amazing. However, the Denon AVR-X1800H Receiver does exhibit some flaws. Despite the flaws, the Denon AVR line of receivers is probably the most practical option available. - setup - the on screen setup, using HDMI to an HDTV, with speaker testing is amazing! - audyssey - I could not get the Denon Audyssey system to produce anything that approached a reasonable experience. I disabled that feature. With audyssey disabled, I have been able to fine tune a wonderful sonic experience. - HDMI passthrough - as wonderful as this feature ought to be, it turns out that it is terrible. First of all, it demands to try to "upscale" all inputs, to a minimum of 2160p. With several computers that I want to display on my big HDTV, including a home data archival server, running the HDMI output from the computer through the Denon creates a completely distorted looking result. It's visually atrocious. - web interface remote control - this is a GREAT feature. Most importantly, the Denon can be controlled directly from any computer by finding the IP address of the Denon on the LAN and simply pointing to it. This is amazing! - Android / iOS remote control - the control interface via the Android OS app is the best and easiest way to operate, control, and adjust the receiver! - sound quality - super overall - running a 7.1 channel setup, using Monolith brand speaks I also purchased on amazon, the surround sound experience is extraordinary. Using the Android or Web interface, I can adjust the levels of individual speakers to fine tune the sonic experience for each movie. The speakers are: Monolith T5 pair front - Monolith T4 pair rear - Monolith D5 front center - vintage (1984) Klipsch KG4 pair secondary front - ELAC SUB1225 Subwoofer. - note - the Denon AVR-X1800H is actually in the middle of the range or the similar receivers that Denon markets. However at this price level the Denon AVR-X1800H already provides what most people need. The addition AVR-X4800H AVR-X5800H AVR-X6800H provide more channels, and more "power", but they seem to maintain similar features. - Heos - have not used it and do not need it. I play all music via an HTPC dedicated computer running vlc media player, iTunes, Kodi, and so on HDMI erac output into the Denon for audio output. - conclusion - overall, except for the nearly unusable HDMI passthrough feature, the Denon AVR-X1800H is delightful. -
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on August 31, 2025
M
Verified Purchase
Marty K
Massapequa, US
★★★★★ 1
Do Not Buy Denon Products
Style: AVR-X1800H
In search of a new A/V receiver, I sought recommendations from my friend, a professional custom home theater installer. He strongly suggested a Denon model, citing its exceptional quality and robust customer support. Regrettably, my experience with this receiver has been diametrically opposed. Upon connecting all components and completing the setup instructions, the unit commenced malfunctioning immediately. Subsequently, when all components were shutoff after I finished watching a program, the receiver turned itself back on. Occasionally, it would also turn on the TV too. Fortunately, I was present during these occurrences. I contacted Denon support, providing a comprehensive description of the issue, including the steps I had taken to resolve it, which entailed restoring the unit to its factory settings. Regrettably, the support representative was unable to provide any information regarding the underlying cause of the problem or offer a solution. When I informed him of my option to return the unit until January 31, 2026, his response was that this may be the most appropriate course of action. Upon looking at reviews of this receiver and Denon receivers in general, this has been an ongoing issue for some time. Therefore, I would not recommend purchasing Denon products.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 14, 2026
B
Verified Purchase
Brucers
Charlottesville, US
★★★★★ 5
An excellent product!
Style: AVR-X2800H, Style: AVR-X2800H
Happy and satisfied does not begin to describe my satisfaction in this Denon product! Setup was a snap, instructions were detailed, and the finale results were amazing. And yes I’m running a full 7.1 setup, sounds fantastic….
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 19, 2026
A
Verified Purchase
Amazon Customer
Phoenix, US
★★★★★ 5
Easy Set Up and Great Sound Distribution
Style: AVR-X3800H
I replaced an old Onkyo 535 with this Denon. It was a significant upgrade. There is zero noise, the Bluetooth is easy to use and provides excellent sound, and the HDMI circuitry is outstanding. The eARC capability is compatible with 2.1 HDMI, and it works seamlessly. Of note, I really like the way it provides the best sound configuration automatically for each source, and I don't have to switch around to find the best sound option. For example, if the source is compatible with Atmos, it provides Atmos. If it's only compatible with Dolby surround, it switches to that. Finally, the distribution of sound is superb. I have a 7.1 speaker configuration of mostly mid-level speakers, and the Denon uses them to their fullest. Rear sounds come clearly from the rear...same with each side, etc. And most of all, I don't have to tweak the system to get that. I just used the provided microphone and ran the set up (which was really easy), and I have really great sound. This unit is a good value.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 28, 2026

recommand products