SKU: 45357149263

DDB1/CRBN Complex, Flag&His Tag, Human

Sale price$162.00 Regular price$180.00
Save 10%

Pay in installments of $45.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 27 - Sep 1

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

DDB1/CRBN Complex, Flag&His Tag, HumanProduct Specification Species Human Synonyms DDB1 CRBN Complex Accession Q16531Q96SW2 Amino Acid Sequence DDB1 Flag Tag, Human Met1 His1140

Product Specification


Species Human
Synonyms DDB1/CRBN Complex
Accession Q16531、Q96SW2
Amino Acid Sequence

DDB1 Flag Tag, Human
Met1-His1140
DYKDDDDKMSYNYVVTAQKPTAVNGCVTGHFTSAEDLNLLIAKNTRLEIYVVTAEGLRPVKEVGMYGKIAVMELFRPKGESKDLLFILTAKYNACILEYKQSGESIDIITRAHGNVQDRIGRPSETGIIGIIDPECRMIGLRLYDGLFKVIPLDRDNKELKAFNIRLEELHVIDVKFLYGCQAPTICFVYQDPQGRHVKTYEVSLREKEFNKGPWKQENVEAEASMVIAVPEPFGGAIIIGQESITYHNGDKYLAIAPPIIKQSTIVCHNRVDPNGSRYLLGDMEGRLFMLLLEKEEQMDGTVTLKDLRVELLGETSIAECLTYLDNGVVFVGSRLGDSQLVKLNVDSNEQGSYVVAMETFTNLGPIVDMCVVDLERQGQGQLVTCSGAFKEGSLRIIRNGIGIHEHASIDLPGIKGLWPLRSDPNRETDDTLVLSFVGQTRVLMLNGEEVEETELMGFVDDQQTFFCGNVAHQQLIQITSASVRLVSQEPKALVSEWKEPQAKNISVASCNSSQVVVAVGRALYYLQIHPQELRQISHTEMEHEVACLDITPLGDSNGLSPLCAIGLWTDISARILKLPSFELLHKEMLGGEIIPRSILMTTFESSHYLLCALGDGALFYFGLNIETGLLSDRKKVTLGTQPTVLRTFRSLSTTNVFACSDRPTVIYSSNHKLVFSNVNLKEVNYMCPLNSDGYPDSLALANNSTLTIGTIDEIQKLHIRTVPLYESPRKICYQEVSQCFGVLSSRIEVQDTSGGTTALRPSASTQALSSSVSSSKLFSSSTAPHETSFGEEVEVHNLLIIDQHTFEVLHAHQFLQNEYALSLVSCKLGKDPNTYFIVGTAMVYPEEAEPKQGRIVVFQYSDGKLQTVAEKEVKGAVYSMVEFNGKLLASINSTVRLYEWTTEKELR
TECNHYNNIMALYLKTKGDFILVGDLMRSVLLLAYKPMEGNFEEIARDFNPNWMSAVEILDDDNFLGAENAFNLFVCQKDSAATTDEERQHLQEVGLFHLGEFVNVFCHGSLVMQNLGETSTPTQGSVLFGTVNGMIGLVTSLSESWYNLLLDMQNRLNKVIKSVGKIEHSFWRSFHTERKTEPATGFIDGDLIESFLDISRPKMQEVVANLQYDDGSGMKREATADDLIKVVEELTRIH
CRBN His Tag, Human
Met1-Leu442
HHHHHHHHGGGSGGGSMAGEGDQQDAAHNMGNHLPLLPAESEEEDEMEVEDQDSKEAKKPNIINFDTSLPTSHTYLGADMEEFHGRTLHDDDSCQVIPVLPQVMMILIPGQTLPLQLFHPQEVSMVRNLIQKDRTFAVLAYSNVQEREAQFGTTAEIYAYREEQDFGIEIVKVKAIGRQRFKVLELRTQSDGIQQA
KVQILPECVLPSTMSAVQLESLNKCQIFPSKPVSREDQCSYKWWQKYQKRKFHCANLTSWPRWLYSLYDAETLMDRIKKQLREWDENLKDDSLPSNPIDFSYRVAACLPIDDVLRIQLLKIGSAIQRLRCELDIMNKCTSLCCKQCQETEITTKNEIFSLSLCGPMAAYVNPHGYVHETLTVYKACNLNLIGRPSTEHSWFPGYAWTVAQCKICASHIGWKFTATKKDMSPQKFWGLTRSALLPTIPDTEDEISPDKVILCL

Expression System Baculovirus-InsectCells
Molecular Weight

128&53kDa (Reducing)

Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tags & Cleavage sites Flag Tag; His Tag
Physical Appearance Liquid
Storage Buffer 20mM Tris,300mM NaCl,10%Glycerol,1mM DTT, pH7.5.
Stability & Storage

·12 months from date of receipt, -20 to -70 °C as supplied.
·1 month, 2 to 8 °C under sterile conditions after reconstitution.
·Please avoid repeated freeze-thaw cycles.

Reference

Fischer E.S.,et al. (2014) Nature 512: 49
He Y.J., et al. (2006) Genes Dev. 20: 2949
Ito T., et al. (2010) Science 327: 1345
Wang H., et al. (2006) Mol. Cell 22: 383

Background

Cereblon (CRBN) is the substrate recognition component of DCX (DDB1-CUL4-X-box) E3 Ubiquitin ligase complexes that mediate the ubiquitination of numerous target proteins including the transcriptional regulator MEIS2. CRBN plays an important role in limb outgrowth, and its function in this process is perturbed by the binding of thalidomide and related compounds. Binding of CRBN to Cullin-4 is mediated in part by DNA damage-binding protein 1 (DDB1), a component of multiple DCX class ligases. In addition to its role in limb development, DDB1 is also involved in various DNA damage response mechanisms. This product consists of an untagged complex of DDB1 and CRBN.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 45357149263

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.7 ★★★★★
Based on 5 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
D
Verified Purchase
David O. Hoagland
Lexington, US
★★★★★ 4
Vintage 60's cool, but sizing is a difficult decision
I can't believe I haven't owned one of these for the last 40 years or so. To put one on after all these years takes one right back to the questionable days of one's youth when you wore these bare chested underneath while tooling around on your Kawasaki 500 triple. Well it will take you back if you haven't let yourself go too far! I received both a large and a medium in black (love the free returns on clothing, I always order two sizes so I get the right fit). They are both made in Mexico and look very neat and well made, the denim is on the thin side but OK for warm weather. Nowhere is there any tag saying shrink to fit or shrinks two sizes. The tag says machine wash cold, tumble dry medium. The large is quite large on me (I'm 5'9" 168 lbs trim and athletic build, more often than not I wear large in T shirts and jackets), the sleeves are way too long and loose, body too long and loose. Would have to shrink drastically to fit me, I really doubt it would shrink anywhere near that much. This type jacket is just all wrong if it's too loose fitting, witness the BLACK color one in the model photos, just not too cool. The medium fits much much smaller but IMHO perfect for this style jacket, a classic fit like Steve McQueen or Robert Plant would have sported, high waist and tight shoulders with sleeves rolled back a little. If you look at the model in the 'HARRINGTON' color you have the idea. It will be totally bitchen on today's big black BMW oilhead. This is the youthful fit I was looking for but any shrinkage would be too much. I am conflicted because I would like to wash this jacket and break it in, put a little wear and tear on it. But I wouldn't dare dry it with heat. I might try washing it in cold water and then line dry or I may just dry clean it. I am tempted to go out and drag it up and down the gravel driveway and run it over with my truck a few times till it acquires some of the same attitude it inspires in me. All I need now is a Psychedelic soundtrack and I'm all set to relive the glory days, better than the first time around. A little research on the Levi's website reveals they have a regular fit and a slim fit in addition to this relaxed fit which is the only one available on Amazon. I find that this relaxed version works well in the medium size anyway, it seems to be relaxed only in the body, not so much in shoulders or sleeves.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 3, 2015
O
Verified Purchase
OPPY
Cuba, US
★★★★★ 5
Fit True to Size
Special Size Type: Standard, Size: Medium, Color: (New) in the Sandbox
Good quality you'd expect from Levis. Fit on the very slightly snug size of true to size. Very nice jacket.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 31, 2026
T
Verified Purchase
tangent
Lake Worth, US
★★★★★ 5
Large fits well, comfortable, though a bit more flex to it than expected
Special Size Type: Standard, Size: Large, Color: Colusa/Stretch
Very nice, though it is stretchier than expected. I purchased a large. The fit is good for me at 5'11" / 200lb, average build. My shoulders are a bit broader than most and the fit is maybe just a weeeeee bit tight, under the arm when reaching for something. The arm length and overall length are both great. This will be a mid-season jacket so I do not plan to wear a hoody or other bulky item under it. It would work, but I think a bit too snug for me. I reccomend washing it immeidately then taking a hot iron with steam to the pockets and collar which I feared were trying to start and curl up. They need to be trained early! I am more pleased than expected.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 30, 2025
N
Verified Purchase
Nick
Lowell, US
★★★★★ 5
TRIED OTHER DENIM JACKETS LEVI THE ONLY WAY
This jacket is exactly what I was hoping for timeless, clean, and super versatile. The black denim looks sharp and goes with everything, from jeans to chinos. The fit is true to size and hits that perfect spot between fitted and comfortable. I can move around easily without it feeling stiff, and it breaks in nicely after a few wears. The quality really stands out — solid stitching, durable buttons, and that signature Levi’s structure that just looks good no matter how you style it. It’s warm enough for cool days but still light enough to wear indoors or layer over a hoodie. Im 180lbs 6’2 for reference, If you’re after that classic denim jacket look that never goes out of style, this one’s it. I get compliments every time I wear it. Also I’ve owned it a year now and it still looks great.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on November 2, 2025
W
Verified Purchase
Walk412
Whiting, US
★★★★★ 5
Levi Sun Surf Type 3 Denim Trucker Jacket - Med Wash
Special Size Type: Standard, Size: Medium, Color: (New) Sun Surf, Special Size Type: Standard, Size: Medium, Color: (New) Sun Surf
Levi Type 3 Trucker jackets are the best you can buy. Every one should own a couple of these. I have every color of the Premium versions, that I bought straight from Levi. I've been wanting to try this Sun Surf type 3 from Amazon for a while now. I bought this one to wear over my hoodies on the cooler days and nights, because of its wide body fit. It's not as slim as the Premiums, but it's just as official. It's super soft and lightweight. The fit and appearance is on point. It looks just like the pictures. Love it! I might get a dark wash as well. Amazon + Levi for the win again!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 15, 2026

recommand products