SKU: 45856748938

Adiponectin His Tag Protein, Human

Sale price$135.00 Regular price$150.00
Save 10%

Pay in installments of $37.50 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Sep 2 - Sep 7

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Adiponectin His Tag Protein, HumanProduct Specification Species Human Synonyms Adiponectin; 30 kDa Adipocyte Complement Related Protein; Adipocyte complement related 30 kDa protein; ACRP30; Adipocyte; C1q and Collagen Domain Containing Protein; Adipose Most Abundant Gene Transcript 1 Protein; apM 1; Gelatin Binding Protein; ADIPOQ; ACDC; ACRP30; APM1; GBP28 Accession Q15848 Amino Acid Sequence

Product Specification


Species Human
Synonyms Adiponectin; 30 kDa Adipocyte Complement-Related Protein; Adipocyte complement-related 30 kDa protein; ACRP30; Adipocyte; C1q and Collagen Domain-Containing Protein; Adipose Most Abundant Gene Transcript 1 Protein; apM-1; Gelatin-Binding Protein; ADIPOQ; ACDC; ACRP30; APM1; GBP28
Accession Q15848
Amino Acid Sequence ETTTQGPGVLLPLPKGACTGWMAGIPGHPGHNGAPGRDGRDGTPGEKGEKGDPGLIGPKGDIGETGVPGAEGPRGFPGIQGRKGEPGEGAYVYRSAFSVGLETYVTIPNMPIRFTKIFYNQQNHYDGSTGKFHCNIPGLYYFAYHITVYMKDVKVSLFKKDKAMLFTYDQYQENNVDQASGSVLLHLEVGDQVWLQVYGEGERNGLYADNDNDSTFTGFLLYHDTNGGGSHHHHHH
Expression System HEK293
Molecular Weight 36 kDa(Reducing)
Purity >95%, by SDS-PAGE under reducing conditions
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at less than 1 mg/mL according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.

Background

Adiponectin(ADPN) is a hormone secreted by adipocytes that regulates energy homeostasis and glucose and lipid metabolism. Adiponectin is a new member of the family of soluble defense collagens, in hematopoiesis and immune responses. It is an important negative regulator in hematopoiesis and immune systems and raise the possibility that it may be involved in ending inflammatory responses through its inhibitory functions. Adiponectin is mapped to 3q27 and can protect the organism from systemic inflammation by promoting the clearance of early apoptotic cells by macrophages through a receptor-dependent pathway involving calreticulin. The standard product used in this kit is the product of gene recombination, consisting of 226(19-244) amino acids with the molecular mass of 36KDa after glycosylation.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 45856748938

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.5 ★★★★★
Based on 16 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
C
coffeeandcode
Carnegie, US
★★★★★ 4
Awesome, portable room divider for larger rooms
Color: Black, Color: Black
I chose this room divider to use in my son's room that also serves as my home office! It is 72" x 72" in size, so it truly blocks out the other side of the room for optimal privacy. Once it's assembled, it's mildly sturdy - as long as you can bet both ends with the "feet" in line with the ground. I wish that the framework poles had more of an interlocking system so that the divider was easier to erect. I assembled this on carpet, so I had some issues getting the divider to stop moving. It takes a lot of work to set up, as it is massive, so definitely have someone help you. I would suggest adding weights of some sort to the feet of this divider to keep it from shifting. I ended up leaning mine against a bookcase shelf so it wouldn't lean. All and all, this is a great product if you are looking to make a room multipurpose.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on August 2, 2025
J
Verified Purchase
John Grey
Port Orchard, US
★★★★★ 5
As described
Color: Black
Light weight, easy to put together and you can disconnect the ends and just roll the whole thing nice and tight for quick out of the way storage. Pretty sturdy, doesn't fall over if you bump into it, you could use it outside but if there's a lot of light you can see through a tiny bit if you're really close but I only tested this indoors so not sure about patio types
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 18, 2025
A
Verified Purchase
Amyth4
Port Orchard, US
★★★★★ 2
Flimsy - choose something else
Color: Black
Very flimsy and barely stands up… better options out there.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on October 11, 2025
L
Lorraine
Omaha, US
★★★★★ 4
Smooth, Stable, and Perfect for Flexible Spaces
Size: 88''W-4 Panel, Color: Grey, Size: 88''W-4 Panel, Color: Grey
This room divider is incredibly easy to move thanks to its industrial-grade silent casters. It glides smoothly across different floor types with just one hand and without any noise, while the built-in wheel locks keep it firmly in place once positioned, no slipping or unwanted movement. The base with reinforced steel feet adds impressive stability, preventing wobbling even in busy or high-traffic areas. I also love the foldable design, which makes storage effortless when it’s not in use. It folds down compactly and fits neatly into small spaces. I gave only 4 stars because I'm not crazy about the color of the fabric. Otherwise this is a very functional way to separate areas.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 7, 2026
K
K
Boise, US
★★★★★ 5
easy to put together, stable and blocks out unwanted eyes.
Size: 88''W-4 Panel, Color: Grey
If you live in a high rise building, or where there is lots of foot traffic and can see in your windows, this is a must have. It's portable, can fold down one or two walls and easy to move around. Put together once, and block out light and eyes while tall enough to see over. You can fold it up along the wall, and use it to block out the blinds or light when using a projector so that it's darker. You can use it to partician the room if you share one, and separate your pile of junk from your room so you don't look at it, can take quite a bit of towel weight and clothes and doesn't tip over. Sturdy bottom metal and easy to put together. I got the grey one, and glad I did. I use it everyday and is part of my room decor. I love it, and after using it for a few months it's quite durable. The quality is there for sure. A tad pricey, but worth it. Must have for a private person.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 28, 2026

recommand products