SKU: 46430987681

Mouse IL-17A Protein, His tag

Sale price$126.00 Regular price$140.00
Save 10%

Pay in installments of $35.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 31 - Sep 5

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Mouse IL-17A Protein, His tagProduct Specification Species Mouse Synonyms Interleukin 17A, IL 17, IL 17A, Cytotoxic T lymphocyte associated antigen 8 (CTLA 8), Il17a, Ctla8, Il17 Accession Q62386 Amino Acid Sequence Protein sequence (Q62386, Thr22 Ala158, with C His tag) TVKAAAIIPQSSACPNTEAKDFLQNVKVNLKVFNSLGAKVSSRRPSDYLNRSTSPWTLHRNEDPDRYPSVIWEAQCRHQRCVNAEGKLDHHMNSVLIQQEILVLKREPESCPFTFRVEKMLVGVGCTCVASIVRQAA Expression System HEK293 Molecular Weight Predicted MW: 17. 1 kDa Observed

Product Specification


Species Mouse
Synonyms Interleukin-17A, IL-17, IL-17A, Cytotoxic T-lymphocyte-associated antigen 8 (CTLA-8), Il17a, Ctla8, Il17
Accession Q62386
Amino Acid Sequence

Protein sequence (Q62386, Thr22-Ala158, with C-His tag) TVKAAAIIPQSSACPNTEAKDFLQNVKVNLKVFNSLGAKVSSRRPSDYLNRSTSPWTLHRNEDPDRYPSVIWEAQCRHQRCVNAEGKLDHHMNSVLIQQEILVLKREPESCPFTFRVEKMLVGVGCTCVASIVRQAA

Expression System HEK293
Molecular Weight Predicted MW: 17.1 kDa Observed MW: 17-25 kDa
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag with C-His tag
Physical Appearance Lyophilized Powder
Storage Buffer

Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.

Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

IL-17A is a proinflammatory cytokine produced by activated T cells. This cytokine regulates the activities of NF-kappa B and mitogen-activated protein kinases. This cytokine can stimulate the expression of IL6 and cyclooxygenase-2 (PTGS2/COX-2), as well as enhance the production of nitric oxide (NO). High levels of this cytokine are associated with several chronic inflammatory diseases including rheumatoid arthritis, psoriasis and multiple sclerosis.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 46430987681

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.8 ★★★★★
Based on 29 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
R
Verified Purchase
Ricki Pickle
Louisville, US
★★★★★ 5
Vibrant and Comfortable
Size: 5 Big Kid, Color: Lavender/Multi, Size: 5 Big Kid, Color: Lavender/Multi
When you have kids, you KNOW how hard it is to get them out of the house! We got these for our daughter and she grew out of them so quickly, (As kids do) but she loved them SO much she just wanted the same shoes in the next size so that’s exactly what we did. She can slip her feet in them SO easily. They have good arch support and they are comfortable enough for her to walk all day at the parks and they are easy to chuck in the washer and dryer to clean them. Unless they change the quality or durability, we will continue to purchase this brand for both ourselves and our kids!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 13, 2025
R
Verified Purchase
Rachel
Alexandria, US
★★★★★ 5
Daughter’s Fav.
Size: 6 Big Kid, Color: Lavender/Multi
These are my preteen daughter’s favorite shoes! She likes that they slip on quickly for those times we are running late. They were comfortable throughout the day during our trip to an amusement park and we walked a lot! They are holding up well and look cute- even after washing!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 29, 2025
N
Verified Purchase
Nadezhda
Lexington, US
★★★★★ 5
So cute and comfy for my little one!
Size: 11 Little Kid, Color: Black
Bought these for my 4 year old daughter and we both love them. She wants to wear them every single day! They fit true to size and look adorable. Great quality for the price.​​​​​​​​​​​​​​​​
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 30, 2026
J
Verified Purchase
Janet Cordes
Dallas, US
★★★★★ 5
Great shoe
Size: 3 Little Kid, Color: Black
Great slip ins. Comfortable and good arch support for high arches. Cute style
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 21, 2025
N
Verified Purchase
NM_HS
Battle Creek, US
★★★★★ 5
Hands free comfort!!
Size: 5 Big Kid, Color: Black
Superb comfortable, great quality and got it at such a good price. My daughter is very happy and wears these every day since a couple of months and they still look new. Best part hands free!!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 1, 2025

recommand products