SKU: 46701614076

Human REG1A Protein, His Tag

Sale price$76.50 Regular price$85.00
Save 10%

Pay in installments of $21.25 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 29 - Sep 3

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human REG1A Protein, His TagProduct Specification Species Human Synonyms Lithostathine 1 alpha, Islet cells regeneration factor (ICRF), Islet of Langerhans regenerating protein (REG), Pancreatic stone protein (PSP), Pancreatic thread protein (PTP), Regenerating islet derived protein 1 alpha (REG 1 alpha), Regenerating protein I alpha, PSPS, PSPS1, REG Accession P05451 Amino Acid Sequence Protein sequence (P05451, Gln23 Asn166, with C His Tag)

Product Specification


Species Human
Synonyms Lithostathine-1-alpha, Islet cells regeneration factor (ICRF), Islet of Langerhans regenerating protein (REG), Pancreatic stone protein (PSP), Pancreatic thread protein (PTP), Regenerating islet-derived protein 1-alpha (REG-1-alpha), Regenerating protein I alpha, PSPS, PSPS1, REG
Accession P05451
Amino Acid Sequence

Protein sequence (P05451, Gln23-Asn166, with C-His Tag) QEAQTELPQARISCPEGTNAYRSYCYYFNEDRETWVDADLYCQNMNSGNLVSVLTQAEGAFVASLIKESGTDDFNVWIGLHDPKKNRRWHWSSGSLVSYKSWGIGAPSSVNPGYCVSLTSSTGFQKWKDVPCEDKFSFVCKFKN

Expression System HEK293
Molecular Weight Predicted MW: 18 kDa Observed MW: 18 kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Conjugation Unconjugated
Physical Appearance Lyophilized powder
Storage Buffer

Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4 with 3% trehalose.

Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

Lithostathine-1-alpha, also known as Regenerating islet-derived protein 1 alpha (REG1A), is a secreted protein encoded by the REG1A gene. It is primarily produced by the pancreas and plays a role in promoting cell proliferation and regeneration. Its name originates from its initial identification as a protein that inhibits calcium carbonate crystal formation, potentially preventing pancreatic stone formation. However, its primary significance lies in its function as a acute-phase reactant and its strong association with inflammatory and malignant conditions. REG1A is markedly overexpressed in diseases such as chronic pancreatitis and pancreatic ductal adenocarcinoma, making it a promising biomarker for early detection and monitoring of these conditions.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 46701614076

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.2 ★★★★★
Based on 18 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
S
Verified Purchase
SamCat
West Palm Beach, US
★★★★★ 5
Almost perfect, could use one more USB-C Gen 2 port and a metal case instead of plastic.
Never really had any problems with Anker gear, I've come to trust the brand name. This little hub is almost perfect for use with my 2019 MacBook Pro, but where Anker really dropped the ball is by not adding one more USB-C port. I mean, there's two, but if one is dedicated to power devices only that doesn't really leave much room for expansion by only giving you one extra, I mean they were thoughtful enough to give you two USB-A ports. I do like that the USB-C and two USB-A ports are version 3.2 Gen 2 rated for up to 10Gbps transfer speeds versus Gen 1 at 5Gbps. The plastic casing does get hot, not sure if aluminum metal would be any better, but it would feel nicer, plastic just feels cheap. Also, a dark case with dark letter printing doesn't work because you can't see the writing, should have used lighter letter coloring. Otherwise, solid performer. I'll keep it along with my other one because having two hubs with a laptop is convenient so I don't have to always haul a hub around from place to place. PROS: • 1 USB-C port version 3.2 Gen 2 rated up to 10Gbps. • 2 USB-A ports version 3.2 Gen 2 rated up to 10Gbps. • Also includes, HDMI, Ethernet, SD and micro SD card ports. CONS: • Plastic casing, gets hot. • Should have one more USB-C port. • Port description lettering is too dark, gets lost against dark case color, should have used white or silver lettering instead. • No audio port.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 7, 2024
M
Verified Purchase
Mares by the Bay
Fort Morgan, US
★★★★★ 5
It WORKS! I'm Back at Work. Thx to Apple for support and Amazon for fast delivery
I am thrilled to report that the Anker USB C Hub with Ethernet fixed a dire problem that nailed me when I switched from my maybe-20 year old dying wired Apple Extended Keyboard to the Macally keyboard comparable (with USB-C connection). I have a 2023 MacBook Pro 14", a lovely workhorse, with 3 USB-C/Thunderbolt ports, a MagSafe power port and an HDMI port (with, it turned out, limited ability to handle UHD displays, so useless for my desk setup). It turned out my old Dockteck hub with ethernet didn't have thunderbolt capable USB-C ports, so my new MacAlly keyboard connected to that hub stopped working. On top of that, as I swapped with my Logi webcam, it also required a trickle of power the Dockteck hub didn't provide. As soon as I figured out what the issue was, I read up on several multiport adapters with ethernet, and it seemed that either I would be stuck purchasing WAY more than I needed, adding another bulky (annoying!) device on my desk surface and costing me close to $200. This seemed crazy, so I called Apple Store support. The only Apple Store multiport adapter was useless to me (and also $80) because, of all weird things, it had only ONE USB-C/Thunderbolt compatible port among 8--most ports were legacy. (Ugly too, just saying folks don't HAVE to make devices ugly!) The Apple Store rep, in one of those brilliant customer rep incidents, understood quickly the challenge, said Apple Store didn't have anything that would work for me, but SHE KNEW SOMEONE (ta-da! better than AI!) who would know and could recommend. Three minutes later she said this Anker device would work. I had it in hand by 6pm same day. So this is not just a rave for a solution that WORKS, but also a thank you to the great support from Apple to get me back to work fast. And Amazon for getting the item to me fast too!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 20, 2026
C
Verified Purchase
Chris
Bozeman, US
★★★★★ 5
Great as long as you know its limitations; runs warm; monitor settings may need to be changed
I reluctantly gave up MagSafe and joined the USB-C future when my employer issued me a new 2019 16" MacBook Pro. Searching for a way to connect my various peripherals I settled on this hub as a reasonable way to connect a 4K display, pass power from the laptop charger (albeit not the full 96W; macOS reports 79W after hub losses—good enough most of the time), connect 1GigE, and provide a few spare USB ports and occasionally-used SD card slots. I've learned a few things: A port that looks like USB-C does not pass video unless it is a "Thunderbolt" port (look for the lightning bolt logo, apparently); connecting a USB-C-to-mini-DisplayPort adapter to the USB-C port on this hub did not allow my monitor to work. Lesson learned. The HDMI port did work, and did pass 4K@60Hz, but only after I adjusted my monitor settings. At first I was convinced either my HDMI cable or this hub were defective, because macOS would only allow me to select 4K@30Hz. I have an LG 4K display, and from reading forums, one must enable 60Hz in the on-screen display menu before the monitor will tell the computer it is capable of displaying 60Hz video. For my monitor, that meant changing "Ratio" in "Quick Settings" to "Original" (it defaulted to "Wide", with a separate configuration for each port), as well as turning on "HDMI ULTRA HD Deep Color" from "Picture" -> "Picture Adjust." After I changed those two settings, 60Hz was not available until I unplugged the HDMI cable from the hub and plugged it in again. After that I had buttery smooth 4K video at 60Hz. The hub works as advertised, at least for my configuration. The 1GigE port works well, and is equivalent to a direct USB-C to Ethernet adapter I tried. It does run warm to the touch as other reviewers have reported. That's not problematic, but I'd prefer it pass the missing 17W to the laptop rather than dissipate it as heat. Time will tell how well the hub holds up, but for now I'm happy. In summary: if you have a new Mac this hub will likely work for you, though you may need to adjust your monitor settings.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on September 1, 2020
A
Verified Purchase
Amazon Customer
Lexington, US
★★★★★ 4
Older flash drives might not work.
Port labels are too faint to read easily and the PD out port isn't labelled (I suppose they thought it was obvious since it has a fixed cable). The USB ports are speedy except it won't recognize any of my several SanDisk Cruzer Glides. Others flash drives work okay. Works great as an iPhone USB C to TV HDMI converter.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 23, 2026
O
Verified Purchase
OG Ro
Dallas, US
★★★★★ 5
Works as intended
I've been into emulators lately and this is a great HDMI out with charging capabilities to go with your high speed charging brick. Doesn't work for everything, but I can attest it works with the AYN Thor and a Google Pixel 8 Pro, and presumably higher end Pixels. Both have emulators and both come thru my TV just fine. Also works with Kodi. I tried to use wired controllers, but quickly figured I'm better off going Bluetooth on that route. I haven't tried file transfer or anything because all that mattered to me was getting it to the big screen. I'd rather have a docking stand for my needs, but freedom and flexibility isn't a bad thing for this device at a decent price and cheaper than a dock.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 10, 2026

recommand products