SKU: 47176477191

Fc epsilon RI α Fc Chimera Protein, Human

Sale price$270.00 Regular price$300.00
Save 10%

Pay in installments of $75.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 26 - Aug 31

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Fc epsilon RI α Fc Chimera Protein, HumanProduct Specification Species Human Antigen Fc epsilon RI Accession P12319 1 Amino Acid Sequence Val 26 Leu204, with C terminal Human IgG1 Fc

Product Specification


Species Human
Antigen Fc epsilon RI
Accession P12319-1
Amino Acid Sequence

Val 26-Leu204, with C-terminal Human IgG1 Fc

VPQKPKVSLNPPWNRIFKGENVTLTCNGNNFFEVSSTKWFHNGSLSEETNSSLNIVNAKFEDSGEYKCQHQQVNESEPVYLEVFSDWLLLQASAEVVMEGQPLFLRCHGWRNWDVYKVIYYKDGEALKYWYENHNISITNATVEDSGTYYCTGKVWQLDYESEPLNITVIKAPREKYWLGGGSGGGSPKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

Expression System HEK293
Molecular Weight 65-72kDa (Reducing)
Purity

>95% by SDS-PAGE

Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag Human Fc Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.

Background

Fc epsilon RI, the high-affinity IgE receptor, distinguishes Ag-IgE interactions and drives cellular allergic responses. Fc epsilon RI is primarily expressed on MCs, basophils and Ag-presenting cells, and mainly exists as the heterotetramer αβγ2. However, there are differences among species: an alternate trimeric form αγ2 is expressed on human, but not rodent. Structurally, it is composed of one α-chain bearing two extracellular immunoglobulin domains that bind to the Fc portion of a single molecule of IgE, a β-chain that holds an immunoreceptor tyrosine-based activation motif (ITAM), and a homodimer of disulfide-bound ITAM-containing γ-chains. Expression of the β chain in mast cells and basophils results in increased Fc epsilon RI surface expression and amplifies signaling through the receptor. The importance of the α-subunit in the Fc epsilon RI-mediated allergic reaction was demonstrated by the absence of allergic reactions in α-subunit-deficient mice. The Fc epsilon RIα binds to the Fc fragment of IgE at a 1:1 ratio to form the IgE-Fc complex. Fc epsilon RI is a unique molecular target that initiates different functional outcomes of MC responses and allergic inflammation. The recognition of multivalent antigen by Fc epsilon RI-bound IgE triggers a complex biochemical pathway initiated by the phosphorylation of ITAM motifs by the Src family kinase Lyn. Fc epsilon RI not occupied by IgE has a half-life on the mast cell surface of 24 hours in vitro, while receptors bound to IgE appear to be expressed for the life of the cell. The density of human basophil FcεR1 expression correlates directly with serum IgE levels, where binding of IgE stabilizes the receptor at the cell surface.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 47176477191

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.0 ★★★★★
Based on 24 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
S
Verified Purchase
Shawn SnoMan Thompson
Fort Morgan, US
★★★★★ 5
For work or casual wear, this polo is a great choice.
Material Type: Recycled Polyester, Color: Port Stripe, Size: X-Large
I really like this polo. I've been wearing it once a week or every other week since November. Its very comfortable and breathable. This polo feels like it should last a while. The fit is good. I typcally wear XL and this XL fits great. I've pruchased it in both burgundy and black so far. I definitely recommend this shirt. For work or casual wear, this will look good.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 11, 2026
T
Verified Purchase
Tech Dad
Alexandria, US
★★★★★ 5
Great value: These are my go-to work from home shirt
Material Type: Recycled Polyester, Color: Blue, Size: X-Large
I’ve been pleasantly surprised by these shirts and wear them weekly for Zoom calls, since I’m still working from home these days. I figured at the price point it was worth trying them out, and now I’ve bought several in different colors. They aren’t super soft, but they are comfy and look nice. I’m 6’1” ~220 pounds, and the XL slim fit still has plenty of room. I imagine the regular cut is incredibly boxy and oversized. The difference between polyester vs recycled polyester is inconsequential. I typically buy expensive golf shirts, and these definitely aren’t as nice. They are a fraction of the cost though and a great “beater” work shirt / hang out shirt. It’s nice wearing something that looks and feels decent, but if something happens to it, you can toss and it and pick up another for the cost of a chipotle burrito.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 29, 2022
E
Verified Purchase
Espresso
Massapequa, US
★★★★★ 3
Great price, not great quality
Material Type: Recycled Polyester, Color: Black, Size: Small
Simple, straight forward all black polo. I am a size medium woman (with some room since I don't like form-fitting) and bought a men's small. Fits perfectly for my frame. Long enough to tuck in for my part-time extra weekend job uniform. Also suitable for the golf course. A little thin, and if you hold it up to light you can sort of see through it. *Not* flowy, soft and smooth fabric like a rash guard/sun shirt - more structured than that. But it's cool and does the job for the price under $10.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on August 13, 2024
K
Verified Purchase
Ken Strech
Port Orchard, US
★★★★★ 5
Recommend
Material Type: Recycled Polyester, Color: Dark Navy, Size: X-Large
Great fit, right price
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 18, 2026
G
Verified Purchase
Gwen
Birmingham, US
★★★★★ 5
Nice polo
Material Type: Recycled Polyester, Color: Dark Teal, Size: Medium
Fantastic polo shirt. Size was true to fit. Color is amazing. It’s soft and it has held up through washes since Christmas.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 14, 2026

recommand products