SKU: 47438163423

Human IL-19, His tag

Sale price$90.00 Regular price$100.00
Save 10%

Pay in installments of $25.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 28 - Sep 2

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human IL-19, His tagProduct Specification Species Human Synonyms Melanoma differentiation associated protein like protein, NG. 1, ZMDA1 Accession Q9UHD0 Amino Acid Sequence Protein sequence(Q9UHD0, Leu25 Ala177, with C 10*His) LRRCLISTDMHHIEESFQEIKRAIQAKDTFPNVTILSTLETLQIIKPLDVCCVTKNLLAFYVDRVFKDHQEPNPKILRKISSIANSFLYMQKTLRQCQEQRQCHCRQEATNATRVIHDNYDQLEVHAAAIKSLGELDVFLAWINKNHEVMFSAGGGGSHHHHHHHHHH Expression System HEK293 Molecular Weight Theoretical: 19. 5kDa Actual: 29kDa

Product Specification


Species Human
Synonyms Melanoma differentiation-associated protein-like protein, NG.1, ZMDA1
Accession Q9UHD0
Amino Acid Sequence

Protein sequence(Q9UHD0, Leu25-Ala177, with C-10*His)
LRRCLISTDMHHIEESFQEIKRAIQAKDTFPNVTILSTLETLQIIKPLDVCCVTKNLLAFYVDRVFKDHQEPNPKILRKISSIANSFLYMQKTLRQCQEQRQCHCRQEATNATRVIHDNYDQLEVHAAAIKSLGELDVFLAWINKNHEVMFSAGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Theoretical: 19.5kDa Actual: 29kDa
Purity

>95% by SDS-PAGE

Endotoxin <1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

· 12 months from date of receipt, -20 to -70 °C as supplied. 
· 6 months, -20 to -70 °C under sterile conditions after reconstitution.
· 1 week, 2 to 8 °C under sterile conditions after reconstitution.  
· Please avoid repeated freeze-thaw cycles.

Background

Interleukin 19 (IL-19) is an immunosuppressive protein that belongs to the IL-10 cytokine subfamily. The IL-19 protein is composed of 159 amino acids and has a quaternary structure with alpha helix motifs and loops. IL-19 is preferentially expressed in monocytes, macrophages, and T and B lymphocytes, but interacts with immune cells (macrophages, T cells, B cells) and non-immune cells (endothelial cells and brain resident glial cells, etc). IL-19 is associated with broad functions across inflammation, cell development, viral responses, and lipid metabolism. As an immunosuppressive cytokine, IL-19 promotes the Th2 (regulatory) T-cell response which supports an anti-inflammatory lymphocyte phenotype, dampens the Th1 T-cell response and inflammatory cytokine secretion (IFNγ), increases IL-10 (anti-inflammatory) expression in peripheral blood mononuclear cells (PBMC), and inhibits the production of immunoglobulin G (IgG) from B cells.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 47438163423

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.7 ★★★★★
Based on 23 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
S
Verified Purchase
susan said so
Fort Morgan, US
★★★★★ 5
BEST Dog Toys EVER! JRT approved
Color: 5pack, Size: Large
🌟 🌟 🌟 🌟 🌟 for these toys! We have terriers who have NEVER met a toy they couldn't destroy... until now. We've had them over a week an all 5 are still intact, crinkly, and squeakers squeaking - and they're played with constantly! When I tell you I've never, in all my years of JRT ownership and rescue, had a toy last 24 hours, much less a WEEK? Well, lots of you will know how astonishing that is! We've currently got 5 dogs (2 fosters, anyone looking for a project?) so the package size is perfect. Get 'em.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 11, 2026
P
Verified Purchase
Palm Tree Villa
Lowell, US
★★★★★ 5
Great toy, they go the distance!
Color: 5pack, Size: Large, Color: 5pack, Size: Large
Best typy of toys for my pups. Love them. They last!! Chewing tug games. Love them. The squeakiest don’t come out ! Big plus’s. and don’t last long with my dogs, which for me is a big plus’s. Those squeakier drive me crazy!! If they get too yucky, toss them in the washer/dryer! Good to go again.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 29, 2026
J
Verified Purchase
Joan Brown
Louisville, US
★★★★★ 4
String but not indestructible.
Color: 5pack, Size: Large
They’re cute and strong for a dog that likes to bite into toys. Not indestructible.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 13, 2026
C
Verified Purchase
CJShaw
Grantham, US
★★★★★ 5
High quality
Color: 5pack, Size: Large
Our Aussie lives these toys! She hasn’t torn any up yet. She did manage to tear off an ear from the cheetah but the rest of the toy is intact after a lot of tugging and biting. Comes with 2 squeakers for more fun. She loves playing with these and will toss them up in the air and chase it by herself.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 28, 2026
P
Verified Purchase
Panda
Dallas, US
★★★★★ 3
Mixed Bag of Dog Squeaky Toys for Small Dogs
Color: 12pack, Size: Small
I recently purchased the SHARLOVY Dog Squeaky Toys for Small Dogs, a pack of stuffed animal puppy toys, and while they offer some positive aspects, there are a few drawbacks that prevent me from giving them a higher rating. One positive aspect of this toy pack is the variety it offers. With 12 different plush dog toys included, there is a range of options to keep my small dog entertained and engaged. The cute designs and soft textures are appealing, and they provide a good selection for different play sessions. The squeaky feature of these toys can be entertaining for dogs, and it adds an element of interactive play. The squeaker is relatively durable and has held up reasonably well during playtime, adding an extra level of excitement for my dog. However, the durability of these toys is a concern. While they are suitable for small dogs and light chewers, they may not withstand the rigorous chewing of more aggressive chewers or larger breeds. The seams on some toys have come apart relatively quickly, resulting in stuffing coming out or potential choking hazards. It is important to supervise playtime and monitor the condition of the toys closely. Another drawback is the size of the toys. While they are marketed for small dogs, some of the toys in the pack are quite small and may pose a choking risk for dogs that are prone to swallowing or have a tendency to tear apart toys. It is essential to choose the appropriate toy size based on your dog's breed and chewing habits. In terms of value for money, the price point for this toy pack is reasonable considering the number of toys included. However, the longevity of the toys may impact the overall value, as they may need to be replaced more frequently for dogs that are rough with their toys. In conclusion, the SHARLOVY Dog Squeaky Toys for Small Dogs offer a variety of cute and soft toys that can entertain small dogs during playtime. The squeaky feature adds to the fun, but the durability of the toys and potential choking hazards are concerns. It is important to choose appropriate toy sizes and supervise playtime to ensure the safety of your furry friend. If you have a small dog and are looking for a variety of soft and squeaky toys, this pack may be worth considering. However, if your dog is an aggressive chewer or larger in size, it may be more prudent to explore more durable and size-appropriate options to ensure the toys can withstand your dog's play habits.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on July 12, 2023

recommand products