SKU: 47851564559

LTBR/TNFRSF3 His tag Protein, Human

$212.40 $236.00
Save 10%
No.2 Bestseller on lamcf.fr >

Pay in installments of $59.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Sep 1 - Sep 6

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

LTBR/TNFRSF3 His tag Protein, HumanProduct Specification Species Human Antigen LTBR TNFRSF3 Synonyms Lymphotoxin beta receptor, Tumor necrosis factor C receptor, Tumor necrosis factor receptor 2 related protein Accession P36941 Amino Acid Sequence Gln31 Met227, with C terminal 8*His

Product Specification


Species Human
Antigen LTBR/TNFRSF3
Synonyms Lymphotoxin-beta receptor, Tumor necrosis factor C receptor, Tumor necrosis factor receptor 2-related protein
Accession P36941
Amino Acid Sequence

Gln31-Met227, with C-terminal 8*His QAVPPYASENQTCRDQEKEYYEPQHRICCSRCPPGTYVSAKCSRIRDTVCATCAENSYNEHWNYLTICQLCRPCDPVMGLEEIAPCTSKRKTQCRCQPGMFCAAWALECTHCELLSDCPPGTEAELKDEVGKGNNHCVPCKAGHFQNTSSPSARCQPHTRCENQGLVEAAPGTAQSDTTCKNPLEPLPPEMSGTMLMGGGSHHHHHHHH
Expression System HEK293
Molecular Weight 27-36kDa
Purity ＞95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1. Piao W., Xiong Y., Li L., et al. Regulatory T cells condition lymphatic endothelia for enhanced transendothelial migration. Cell Reports. 2020;30(4):1052-1062.e5.
2. Schneider K, Potter KG, and Ware CF (2004). Lymphotoxin and LIGHT signaling pathways and target genes. Immunol. Rev. 202, 49-66.
3. Norris P.S., Ware C.F. Madame Curie Bioscience Database. Landes Bioscience; Austin, TX, USA: 2000-2013.
4. Force W.R., Walter B.N., Hession C., Tizard R., Kozak C.A., Browning J.L., Ware C.F. Mouse lymphotoxin-beta receptor. Molecular genetics, ligand binding, and expression. J. Immunol. 1995; 155:5280-5288.
5. Boehm T., Scheu S., Pfeffer K., Bleul C.C. Thymic medullary epithelial cell differentiation, thymocyte emigration, and the control of autoimmunity require lympho-epithelial cross talk via LTbetaR. J. Exp. Med. 2003; 198:757-769.

Background

LTBR is a type 1 single transmembrane protein and member of the tumor necrosis factor receptor (TNFR) family that plays a critical role in the development of secondary lymphoid organs. The human LTBR gene is located on chromosome 12p13, in the same locus as two other members of the TNFR family—TNFR1 and CD27. The human LTBR gene shares 76% homology at the nucleic acid level with its mouse counterpart, located on chromosome 6. LTBR is widely expressed in blood and LECs, intestinal epithelial cells, dendritic cells (DCs), and lymph node (LN) stromal cells. The protein is conspicuously absent in T cells, B cells, and NK cells. LTBR binds strongly to two different natural ligands in homeostatic conditions, LTα1β2 and LIGHT (TNFSF14). LTBR signaling pathway plays an essential role in lymphatic organogenesis, tissue regeneration, organ development, tumorigenesis, and immune response to pathogen infection. Functionally, the absence of LTBR signaling leads to the retention of mature T cells in the thymic medulla.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 47851564559

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.1 ★★★★★
Based on 7 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
L
Verified Purchase
Lucas Crow
Dallas, US
★★★★★ 5
Fantastic for the money
I use this watch at work, so about 40 hours a week I wear it. I work outside in a commonly rainy area, and it's not uncommon for the watch to get wet. I've had it for a couple months or so now, and it really works great! Honestly all of the complaints I have about it can be fixed solely by looking at the price. The viewing angle isn't fantastic - it's a $13 watch. It does lose a little bit of time (a second or two within a week, maybe) - it's a $13 watch. The band is a bit uncomfortable (though it does hold very well, and has lots of size options) - it's a $13 watch. Those are minor things. Here's the good stuff. -Super easy to read -Very easy to use and set -Multiple features -Is genuinely waterproof. I haven't held it underwater, or anything, but for what I would consider 'average' use, it is perfectly waterproof. -Has an adjustable band that doesn't fall off -Fairly tough. I don't treat mine very well and it's held up perfectly fine so far. -It's cheap!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 21, 2019
S
Verified Purchase
S. Murray
New York, US
★★★★★ 4
Cheap Gshock replacement, good value
For $13 this is a steal. It's essentially a casio illuminator w larger bright dial, press once for 5 sec of light then goes dark. Date, time (12 and 24hr), stop watch. The basics, all I needed. A+ Edit: updated the waterproofing is non-existent. It's not even water resistant so treat accordingly don't bring into the shower. The face plastic cracked on me from moderate use, still legible and since I don't test it with water not an issue. The buttons are very sensitive so activities like lifting can cause the bottom left button to depress and switch to stopwatch, or engage the stopwatch. After over a year use I still rank this as a good value. It does the one thing I wish Casio would do is improve light illumination time. The buttons depress easier than Casio's which is a bonus imo, but can be aggravating to some. The water resistance doesn't exist so purchase accordingly.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on November 29, 2023
G
Verified Purchase
Garrett Mitchell
Waukegan, US
★★★★★ 5
Great watch, wristband wears out after a while. Uses a Skmei 1251 band.
Watch is reliable, doesn't drift in time too much, very efficient on battery, has gotten complimented on the look a few times and has a nice user interface. It's also great to be able to see the date without pressing any buttons. The band has fatigued and snapped after many months of putting on and taking off the watch, but If you'd like to find a replacement band, search for Skmei 1251 wristbands.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 8, 2025
A
Verified Purchase
Amazon Customer
Massapequa, US
★★★★★ 5
Inexpensive sports watch that was easy to set up and works well.
I have had this watch for a few days. The included instructions were very basic, but I figured out how to set everything up pretty easily. The watch band is pretty adjustable, fits my fairly wide wrists very well. For the price, about half the cost of the name brand very similar watch it replaced, the watch works well, I am very pleased.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 22, 2026
B
Verified Purchase
BucksOnly
Omaha, US
★★★★★ 5
This is a great watch for the price!
I purchased this watch to use mostly down at my cabin. It is well-made, the functions are easy to use, and it has withstood all the abuse I’ve put it through. I wear this while hunting, cutting firewood, riding ATVs, and just running around the timber. If I destroy this watch in six months, it will be well worth the money I paid for it, but I don’t think that’s going happen. It’s stylish enough to wear to the office and just going out. If you’re looking for an every day watch, you’re not worried about destroying, this is the one to get.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 11, 2023

recommand products

Pflueger President® Inline Ice Combo
83.99
Ugly Stik GX2™ LE Spinning Combo
79.95
Pflueger President® LE Spinning Reel
74.95
Berkley Soft Bait Binder-up to 42 bags
34.99
Plano Guide Series™ Waterproof Case 3500®
34.99