SKU: 48024559452

LILRA2 His Tag Protein, Human

Sale price$324.00 Regular price$360.00
Save 10%

Pay in installments of $90.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 29 - Sep 3

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

LILRA2 His Tag Protein, HumanProduct Specification Species Human Synonyms CD85H,LIR7 Accession Q8N149 1 Amino Acid Sequence Gly24 Asn449, with C terminal 8*His

Product Specification


Species Human
Synonyms CD85H,LIR7
Accession Q8N149-1
Amino Acid Sequence

Gly24-Asn449, with C-terminal 8*His GHLPKPTLWAEPGSVIIQGSPVTLRCQGSLQAEEYHLYRENKSASWVRRIQEPGKNGQFPIPSITWEHAGRYHCQYYSHNHSSEYSDPLELVVTGAYSKPTLSALPSPVVTLGGNVTLQCVSQVAFDGFILCKEGEDEHPQRLNSHSHARGWSWAIFSVGPVSPSRRWSYRCYAYDSNSPYVWSLPSDLLELLVPGVSKKPSLSVQPGPMVAPGESLTLQCVSDVGYDRFVLYKEGERDFLQRPGWQPQAGLSQANFTLGPVSPSHGGQYRCYSAHNLSSEWSAPSDPLDILITGQFYDRPSLSVQPVPTVAPGKNVTLLCQSRGQFHTFLLTKEGAGHPPLHLRSEHQAQQNQAEFRMGPVTSAHVGTYRCYSSLSSNPYLLSLPSDPLELVVSEAAETLSPSQNKTDSTTTSLGQHPQDYTVENGGGSHHHHHHHH

Expression System HEK293
Molecular Weight

70-90kDa (Reducing)

Purity

>95% by SDS-PAGE

Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution

Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.

Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.

Background

Leukocyte immunoglobulin-like receptors (LILRs) are inhibitory, stimulatory or soluble receptors encoded within the leukocyte receptor complex. LILRs includes activating (LILRA1, LILRA2, LILRA3) and inhibitory (LILRB1, LILRB2, LILRB3, LILRB4, LILRB5) isoforms. LILRA2, also known as CD85H and LIR7 (Leukocyte immunoglobulin-like receptor 7), is expressed predominantly on monocytes and B cells, and at lower levels on dendritic cells and natural killer cells. The encoded protein is an activating receptor that inhibits dendritic cell differentiation and antigen presentation and suppresses innate immune response. It consists of 2-4 extracellular Ig-like domains, a transmembrane domain (TM), and a short cytoplasmic tail. LILRA2 contains 4 Ig-like C2 type domains in the extracellular region. LILRA2 was recently reported to bind to other unique ligands, the bacterially degraded Igs (N-truncated Igs), for the activation of immune cells.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 48024559452

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.2 ★★★★★
Based on 25 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
D
Verified Purchase
D. Wetherbee
Dallas, US
★★★★★ 5
Nice Everyday Watch
Color: Silver-tone/White
The watchband was a bit too big and no one seems to be able to take out a link. Other than that, it's an excellent inexpensive everyday watch
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 10, 2026
F
Verified Purchase
Fred Turek
Natrona Heights, US
★★★★★ 1
Great watch, terrible band. Had two of these, both bands fell apart within weeks.
Color: Silver-tone/White, Color: Silver-tone/White
I had one just like this before. Great watch except they made one very bad change in the band which makes them fall apart within weeks. They don't tell time if you have to throw them in the garbage because of bands that fell apart. I like it, a nice clean dial, works fine, and you can make it light up to check the time in the dark. But some idiot made a terrible design change in the band. The center 1/3" of band is not twistable and falls apart easily. I've had two of these; both fell apart within weeks. The previous similar one that I owned without this design defect lasted me many years.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 29, 2024
R
Verified Purchase
Rhaelee BooHer
Massapequa, US
★★★★★ 5
its a simple watch
Color: Silver-tone/White
This was a gift for my 80 Y/O father, the numbers are easy to read and the date (Numbered day only) will have to be adjusted if the month is 30 days instead of 31. The wristband fit perfectly, so there was no adjustment of links. He has had it for a month now and forgot to take it off when he entered the shower, still works, but wont let that happen again. If it lasts a year I will be happy, it wasn't expensive for a Timex and the silver color looked like silver.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on July 3, 2024
J
Verified Purchase
Jesse Byock, Jules William Press
Cuba, US
★★★★★ 5
Watch face in the dark
Color: Silver-tone/White
The indigo really works!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on October 12, 2025
E
Verified Purchase
ESPADRILLE COMFORT
Dallas, US
★★★★★ 3
Time work watch
Color: Silver-tone/White
Inexpensive work watch, they last forever, the only complaint I have is that the band broke and I couldn’t find a replacement band, so I had it repaired instead , the watch works great.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 22, 2024

recommand products