SKU: 49088965308

Human Plectin, His tag

Sale price$112.50 Regular price$125.00
Save 10%

Pay in installments of $31.25 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 28 - Sep 2

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human Plectin, His tagProduct Specification Species Human Synonyms Hemidesmosomal protein 1 (HD1), Plectin 1, PLEC1 Accession Q15149 Amino Acid Sequence Protein sequence (Q15149, Leu86 Val180, with C 10*His) LHLPPEIVPASLQRVRRPVAMVMPARRTPHVQAVQGPLGSPPKRGPLPTEEQRVYRRKELEEVSPETPVVPATTQRTLARPGPEPAPATDERDRVGGGGSHHHHHHHHHH Expression System E. coli Molecular Weight Predicted MW: 12. 4 kDa Observed MW: 16 kDa Purity 95% by SDS PAGE Endotoxin <1EU g Tag with C 10*His Physical

Product Specification


Species Human
Synonyms Hemidesmosomal protein 1 (HD1), Plectin-1, PLEC1
Accession Q15149
Amino Acid Sequence

Protein sequence (Q15149, Leu86-Val180, with C-10*His) LHLPPEIVPASLQRVRRPVAMVMPARRTPHVQAVQGPLGSPPKRGPLPTEEQRVYRRKELEEVSPETPVVPATTQRTLARPGPEPAPATDERDRVGGGGSHHHHHHHHHH

Expression System E.coli
Molecular Weight Predicted MW: 12.4 kDa Observed MW: 16 kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Tag with C-10*His
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

Plectin is a giant protein found in nearly all mammalian cells which acts as a link between the three main components of the cytoskeleton: actin microfilaments, microtubules and intermediate filaments. In addition, plectin links the cytoskeleton to junctions found in the plasma membrane that structurally connect different cells. By holding these different networks together, plectin plays an important role in maintaining the mechanical integrity and viscoelastic properties of tissues. Mutations in PLEC have been associated with epidermolysis bullosa simplex with muscular dystrophy. A missense variant of PLEC has been recently proposed as a cause of atrial fibrillation in some populations. Isolated left ventricular non-compaction accompanying epidermolysis bullosa simplex with muscular dystrophy was also noted. Plectin has been proposed as a biomarker for pancreatic cancer. Although normally a cytoplasmic protein, plectin is expressed on the cell membrane in pancreatic ductal adenocarcinoma (PDAC) and can therefore be used to target PDAC cells.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 49088965308

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.1 ★★★★★
Based on 6 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
M
Verified Purchase
musicmenman
Bozeman, US
★★★★★ 5
Great frother at a good price
Color: Black, Size: normal
Works really well and priced appropriately. Produces rich froth with minimal effort and works MUCH better than other much higher priced frothers. Highly recommended. I hope it lasts a good long time.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 13, 2026
C
Verified Purchase
Cooper Drenner
Massapequa, US
★★★★★ 5
Perfect for protein shakes and coffee - one warning about getting it wet
Color: Black, Size: normal
Bought this to replace a similar handheld whisk I had been using for protein shakes and stirring extras into my morning coffee. At this price point I was not expecting much, and it has done exactly what I need - with one warning I will get to. I use this almost every morning. Two jobs: mixing a scoop of whey protein into water or milk so it actually dissolves (no clumps stuck to the side of the shaker), and stirring pre-workout powder or a flavor additive into my coffee. This is not a blender and I do not treat it like one. For small-volume mixing of powders into liquid, it is the right tool. WHAT WORKS - It does not over-froth or whip air into the drink. Some handheld whisks turn a protein shake into a foam mess. This one keeps the liquid liquid - it just dissolves the powder. That is the main reason I came back to this category. - No splashing, even with the cup near the brim. I can stir a nearly-full coffee mug without flicking liquid onto the counter. The previous one I owned could not do this. - One button. Runs as long as I hold it. A typical protein shake or coffee mix takes under ten seconds. - Easy to hand-wash. Rinse the whisk end, wipe the handle, back in the drawer. WHAT DOES NOT (the warning) - You cannot throw the whole thing in the sink with the rest of the dishes. The handle is not waterproof. We made this mistake exactly once - it got soaked, never worked again. At this price the loss was not a big deal, but it is the one thing I wish the listing made more obvious. Hand-clean the whisk end only, keep the handle dry. - Battery-powered. Replace the batteries when it starts feeling slow rather than waiting for it to fully die mid-shake. WHO IT IS FOR If you need a small-volume mixer for protein powder, coffee, hot chocolate, pre-workout, or anything where you are dissolving a powder into a single cup or shaker, this is the tool. If you want to blend smoothies or actually break down ingredients, buy a real immersion blender instead. Five stars. The wet-handle failure was my mistake, not the product's. Doing its job every morning - would buy again.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 24, 2026
D
Verified Purchase
Daniel Flynn
Natrona Heights, US
★★★★★ 4
$7 value
Color: Black, Size: normal
Works wonderfully if the liquid you’re blending has no viscosity, but it slows down brutally if given any kind of resistance. It’s small and lightweight and very easy to use. Works for my bloom, but it does not work very well for my protein shakes.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 28, 2026
J
Verified Purchase
Jay n Debbie (Pillars-Of-Truth)
Belleville, US
★★★★★ 5
Strong, Durable, and SIMPLE Frother
Color: Gray
Excellent frother! It is ‘SIMPLE’, yet very efficient blending. I love that it included a set of long-lasting batteries. The motor on this frother is strong and works great. The item itself is of durable quality. I have had mine for about 9 months and use it daily for my coffee and other drinks throughout my week, and the battery is still running. I even give it a spin after washing the frother spinner/coil. This helps to dry it thoroughly, as the motor is strong enough to blow away any excess water - and still - the batteries are functioning well. The price is just right…very affordable compared to other brands. I’m very pleased with this purchase and absolutely love that it also came with a stand. I display it on my counter everyday. There are 3 solid and Simple colors to choose from, making this an easier shopping experience. Excellent choice for gifting!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 19, 2026
A
Verified Purchase
Avista
Port Orchard, US
★★★★★ 5
Found the perfect chai frother on a budget!
Color: Glossy Black
Okay so I'll be honest, I spent way too long researching milk frothers before pulling the trigger on this one lol. As someone who grew up drinking chai every single day, having a good frother is kind of a big deal in my house. This little thing has been absolutely worth every penny. First off – it's SO easy to use. My 7 year old actually thinks it's the coolest thing ever and wants to help make my morning coffee now, which is honestly adorable. It just works, no fuss, no learning curve. What really sold me compared to other options was the USB-C charging. No more buying AA batteries every few weeks – that stuff adds up! I just plug it into the same charger as my phone. Super convenient. And here's a small thing that matters more than you'd think – it stands on its own! I don't need a separate stand cluttering up my already busy kitchen counter. Build quality feels solid, the stainless steel whisk looks clean and is easy to rinse off. For the price, honestly I expected less. Highly recommend if you're on the fence!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 24, 2026

recommand products