SKU: 50192802420

Human CKB, His tag

Sale price$94.50 Regular price$105.00
Save 10%

Pay in installments of $26.25 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 30 - Sep 4

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human CKB, His tagProduct Specification Species Human Synonyms Creatine kinase B type, Brain creatine kinase (B CK), Creatine kinase B chain, Creatine phosphokinase B type (CPK B), CKBB Accession P12277 Amino Acid Sequence Protein sequence (P12277, Met1 Lys381, with C His tag)

Product Specification


Species Human
Synonyms Creatine kinase B-type, Brain creatine kinase (B-CK), Creatine kinase B chain, Creatine phosphokinase B-type (CPK-B), CKBB
Accession P12277
Amino Acid Sequence

Protein sequence (P12277, Met1-Lys381, with C-His tag) MPFSNSHNALKLRFPAEDEFPDLSAHNNHMAKVLTPELYAELRAKSTPSGFTLDDVIQTGVDNPGHPYIMTVGCVAGDEESYEVFKDLFDPIIEDRHGGYKPSDEHKTDLNPDNLQGGDDLDPNYVLSSRVRTGRSIRGFCLPPHCSRGERRAIEKLAVEALSSLDGDLAGRYYALKSMTEAEQQQLIDDHFLFDKPVSPLLLASGMARDWPDARGIWHNDNKTFLVWVNEEDHLRVISMQKGGNMKEVFTRFCTGLTQIETLFKSKDYEFMWNPHLGYILTCPSNLGTGLRAGVHIKLPNLGKHEKFSEVLKRLRLQKRGTGGVDTAAVGGVFDVSNADRLGFSEVELVQMVVDGVKLLIEMEQRLEQGQAIDDLMPAQK

Expression System HEK293
Molecular Weight Predicted MW: 44.3 kDa Observed MW: 45-55 kDa
Purity >90% by SDS-PAGE
Endotoxin <0.1EU/μg
Tag with C-His tag
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

Brain-type creatine kinase also known as CK-BB is a creatine kinase that in humans is encoded by the CKB gene. The protein encoded by this gene, CK-BB, consists of a homodimer of two identical brain-type CK-B subunits. BB-CK is a cytoplasmic enzyme involved in cellular energy homeostasis, with certain fractions of the enzyme being bound to cell membranes, ATPases, and a variety of ATP-requiring enzymes in the cell. There, CK-BB forms tightly coupled microcompartments for in situ regeneration of ATP that has been used up. The protein reversibly catalyzes the transfer of "energy-rich" phosphate between ATP and creatine or between phospho-creatine (PCr) and ADP. Its functional entity is a homodimer (CK-BB) in brain and smooth muscle as well as in other tissues and cells such as neuronal cells, retina, kidney, bone, etc. Ectopic expression (CKBE) of the B (brain) type of creatine kinase (CK-BB) in red cells and platelets is a rare, benign anomaly detected during a newborn screening program for Duchenne muscular dystrophy.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 50192802420

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.7 ★★★★★
Based on 17 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
S
Verified Purchase
striker
Omaha, US
★★★★★ 5
Good hard use watch.
Color: Black/Silver-Tone
Review Calibration: 3 stars means it works as advertised, nothing special during use, and no amazing features. Higher stars mean better-than-expected performance and features. This is 5 stars because it is my favorite work/hard-use watch. I have been wearing one for years, and like all Timex watches, it can take a beating. I have to replace it when the band's ears get so damaged that they won't hold the band on. This has more to do with the plastic's lifespan than with a design issue. I am hard on watches. This watch normally lasts ne 7-10 years between replacements.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 27, 2026
A
Verified Purchase
Amazon Customer
Carnegie, US
★★★★★ 5
Great watch
Color: Black/Silver-Tone
Great watch, with many features, specially for those that travel in various time zones.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 7, 2026
M
Verified Purchase
Marc McC
Battle Creek, US
★★★★★ 4
Typical Ironman quality
Color: Black/Silver-Tone
This is my fourth Timex Ironman watch. I own many watches, and prefer the Ironman for casual wear and sporting activities as well as swimming and snorkeling. I decided to replace an earlier model with this one rather than pay to change the battery. The Ironman has changed very little over the years since its introduction in the '80s, with the exception of cosmetic improvememnts and a larger display. I selected the "oversize" model as I was looking for a little more heft to this model. This watch fits the bill, not as chunky as my G-Shock. A pleasant surprise was the weight of the watch. This model is lightweight, another advantage over the G. It's larger than the typical Ironman model, but about the same weight. The band lacks the stiffness of some other Timex and Casio models, and is quite comfortable. Typical Ironman functions are unchanged, and the ability to "hide" various functions makes operation of the watch more efficient. There are three time zones, useful when traveling, as well as the usual chronograph/timer and alarm functions. I haven't worn the watch in the pool or ocean yet, but if experience is any guide, I expect no problems. I've never had an Ironman leak, whether during water sports or snorkeling. These are great watches for the money. I prefer 200 meter water resistance for this type of watch, but Timex has yet to build an Ironman 200m that doesn't overwhelm my wrist in weight and size. I'm not a big guy, and they are simply too large for my wrist. Looking forward to years of service with this watch. Definitely a good timepiece for the price.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 6, 2013
L
Verified Purchase
L C
Draper, US
★★★★★ 5
Will not be disappointed
Color: Black/Blue
Keeping in mind that I received this item yesterday (2/24/16), I absolutely love this watch. The reason I have so much confidence with this watch is because I've owned one other Timex similar to this one, and it served me extremely well and is still able to do so. First off, this watch is certainly aesthetically pleasing. The blue color around the face of the watch and outline in the band, goes really well with the black frame. It's just an overall nice looking watch. More importantly, the quality seems great. As I mentioned, I've owned a Timex expedition, which I've had for more than 2 years, and it's still working perfectly fine. The watch seems like it's put together very well and there's no loose or flimsy parts. One complaint that many people seem to have with Timex is the quality of their band. Unfortunately I'd have to agree, since the band on my other Timex that's still working like the first day I got it, cracked and broke and is only being held together by the nylon fabric on the other side of the band. You're not going to have that problem with this watch. It's a full nylon band with Velcro adjustment, for precise fitting. it feels extremely comfortable and you won't need to worry about the band cracking (although I'm sure there will be certain defects in a mass produced bunch). I will use this watch for work and running, and rarely plan on taking it off. Just to give you an idea, I also have a garmin gps watch that I love and obviously has more functions than this watch. However, the second I received this watch, I slapped it on and put my garmin to the side. This watch also looks amazing when you wear it. I'll update this feedback as needed, but I'm confident this watch will serve me for years to come, just as my other one has.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 25, 2016
T
Verified Purchase
TheGenuineBeavis
Louisville, US
★★★★★ 5
Greatest watch I've ever had, but changing batteries is near impossible
Color: Black/Blue
This is the 3rd time I've bought this watch. Same brand, same or very similar model. It has a chronometer, timer, alarm, and of course the clock. It has something I think is for "occasions" but I don't know what it does and don't really care about it. The watch is durable. It uses battery power efficiently. The indiglo is second to none. I just really really like this watch. Having said all that, if you want to change the batteries, good luck, you'll need it. Once you manage to get the backing off of it and open it up (which is a little tricky in itself), it's like a comedy routine where you see some stooge open an electrical device and a buncha parts and springs go flying everywhere. And of course, they are so tiny, you'll never find them once they fly out. That was the exact scenario I found myself in the last time I tried to change the battery. It made me so mad I actually bought another brand of watch that I thoroughly researched. But that watch DIDN'T use battery power efficiently, and it had a host of other minor problems that added up to the conclusion that it was not nearly as great as this Timex. So, for the 3rd time, I found myself buying this Timex watch. So it's a wonderful watch in every way except longevity because changing the batteries has historically been a nightmare for me.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 4, 2019

recommand products