SKU: 50671232315

Biotinylated CD40 Fc&Avi Tag Protein, Human

Sale price$220.50 Regular price$245.00
Save 10%

Pay in installments of $61.25 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 29 - Sep 3

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Biotinylated CD40 Fc&Avi Tag Protein, HumanProduct Specification Species Human Synonyms CD40, Bp50, CDW40, MGC9013, TNFRSF5 Accession P25942 Amino Acid Sequence Glu21 Arg193, with C terminal Human IgG1 Fc & Avi Tag

Product Specification


Species Human
Synonyms CD40, Bp50, CDW40, MGC9013, TNFRSF5
Accession P25942
Amino Acid Sequence

Glu21-Arg193, with C-terminal Human IgG1 Fc & Avi Tag EPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCVLHRSCSPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCHPWTSCETKDLVVQQAGTNKTDVVCGPQDRLRIEGRMDPKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKGLNDIFEAQKIEWHE

Expression System HEK293
Molecular Weight

55-60kDa

Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Biotin
Tag Human Fc Tag, Avi Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution

Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.

Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1、Chatzigeorgiou A, et al. (2009) CD40/CD40L signaling and its implication in health and disease. Biofactors. 35(6): 474-83.

2、Li R. et al. (2009) Expression of CD40 and CD40L in Gastric Cancer Tissue and Its Clinical Significance. Int J Mol Sci. 10(9): 3900-17.

3、Lievens D. et al. (2009) The multi-functionality of CD40L and its receptor CD40 in atherosclerosis. Thromb Haemost. 102(2): 206-14.

Background

CD40 is also known as TNFRSF5, Bp50, CDW40, MGC9013, TNFRSF5 and p50, is a member of the TNF receptor superfamily which are single transmembrane-spanning glycoproteins, and plays an essential role in mediating a broad variety of immune and inflammatory responses including T cell-dependent immunoglobulin class switching, memory B cell development, and germinal center formation. CD40 is a costimulatory protein found on antigen presenting cells and is required for their activation. The binding of CD154 (CD40L) on TH cells to CD40 activates antigen presenting cells and induces a variety of downstream effects. CD40 contains 4 cysteine-rich repeats in the extracellular domain, and is expressed in B cells, dendritic cells, macrophages, endothelial cells, and several tumor cell lines. Interaction of CD40 with its ligand, CD40L, leads to aggregation of CD40 molecules, which in turn interact with cytoplasmic components to initiate signaling pathways. Early studies on the CD40-CD40L system revealed its role in humoral immunity. Both CD40 and CD40 L have a membrane form and a soluble form generated by proteolytic cleavage or alternative splicing. CD40 and CD40L are widely expressed in various types of cells, among which B cells and myeloid cells constitutively express high levels of CD40, and T cells and platelets express high levels of CD40L upon activation. CD40L self-assembles into functional trimers which induces CD40 trimerization and downstream signaling. CD40/CD40L immune checkpoint leads to activation of both innate and adaptive immune cells via two-way signaling. CD40/CD40L interaction also participates in regulating thrombosis, tissue inflammation, hematopoiesis and tumor cell fate. The mechanisms of benefits include immune cell activation and tumor cell lysis/apoptosis in malignancies, or immune cell inactivation in autoimmune diseases and allograft rejection.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 50671232315

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.3 ★★★★★
Based on 8 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
E
Verified Purchase
Evelyn Davis
Fort Morgan, US
★★★★★ 5
Air filters are great
Size: 10-24 4RUNNER, 10-23 GX460
I received when promised and it fit my automobile correctly, I get good gas mileage already so we will see if the gas mileage comes up. The quality was great always looking for high quality when changing the air filters and this item met that standard. Go ahead and buy it will meet you demands.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 24, 2026
K
Verified Purchase
Kristina
Louisville, US
★★★★★ 4
Great value
Size: 18-26 Expedition, 15-26 F-150, 18-26 Navigator
The engine air filter fit perfect. The cabin air filter was a bit of a challenge fitting. seemed to be a bit larger but it went in and got the cap back on the box. For the price you cant beat it. Would buy again!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 15, 2026
S
Verified Purchase
Storyteller
Phoenix, US
★★★★★ 5
Great Filter Set for Allergy‑Sensitive Families and MPG‑Minded Drivers
Size: 21-25 TLX, 18-25 Odyssey
I bought this set because I prefer handling routine maintenance myself, especially cabin and engine air filters, rather than paying dealership prices for simple jobs. The package included one cabin air filter and one engine air filter, plus a full backup set for the next service interval. Both filters installed easily and fit the 2018 Honda Odyssey exactly as expected. No trimming, no forcing, and no alignment issues. The cabin filter seated cleanly in the glove‑box housing, and the engine filter dropped into the airbox without any airflow restriction or sealing gaps. This setup is ideal for Odyssey owners who want to maintain optimal cabin air quality—especially helpful for families with allergies—and for drivers looking to keep engine airflow unrestricted for the best possible MPG and throttle response. It may not be necessary for anyone who relies exclusively on dealership service or doesn’t perform their own maintenance. Overall, this is a straightforward, high‑value filter set that installs cleanly and supports both air quality and engine efficiency for DIY‑minded Odyssey owners.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 26, 2026
T
Verified Purchase
Tom Crum
Natrona Heights, US
★★★★★ 5
Auto air filters
Size: 16-22 Pilot, 14-16 MDX
Perfect - product great - installation easy and much cheaper than having dealer or auto shop do it ——
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 30, 2026
C
Verified Purchase
Christopher Flores
Alexandria, US
★★★★★ 5
Very good option
Better than the oiled version, if you're not chasing track performance. Fit perfectly into my Accord. I still get 34MPG, so it's at least as good or better than OEM, and still better than other options you'll find. No complaints here.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 12, 2026

recommand products