Pay in installments of $25.50 with
,
and
Shipping Estimate
USA
- USA
- CAN
- USA
- CAN
Ships within 48 hours · Estimated delivery Aug 29 - Sep 3
Promo Codes Available:
For Your Every Summer RSVP, with Code: SUMMER15
Description
IL-13 Protein, HumanProduct Specification Species Human Synonyms IL13, ALRH, BHR1, MGC116786, MGC116788, MGC116789, P600, Interleukin 13 Accession P35225 Amino Acid Sequence Gly35 Asn146, with C terminal 8*His GPVPPSTALRELIEELVNITQNQKAPLCNGSMVWSINLTAGMYCAALESLINVSGCSAIEKTQRMLSGFCPHKVSAGQFSSLHVRDTKIEVAQFVKDLLLHLKKLFREGRFNGGGSHHHHHHHH Expression System HEK293 Molecular Weight 30 35kDa Purity >95% by SDS PAGE Endotoxin <0. 1EU g Conjugation Unconjugated Tag His Tag Physical
Product Specification
| Species | Human |
| Synonyms | IL13, ALRH, BHR1, MGC116786, MGC116788, MGC116789, P600, Interleukin-13 |
| Accession | P35225 |
| Amino Acid Sequence | Gly35-Asn146, with C-terminal 8*His GPVPPSTALRELIEELVNITQNQKAPLCNGSMVWSINLTAGMYCAALESLINVSGCSAIEKTQRMLSGFCPHKVSAGQFSSLHVRDTKIEVAQFVKDLLLHLKKLFREGRFNGGGSHHHHHHHH |
| Expression System | HEK293 |
| Molecular Weight | 30-35kDa |
| Purity | >95% by SDS-PAGE |
| Endotoxin | <0.1EU/μg |
| Conjugation | Unconjugated |
| Tag | His Tag |
| Physical Appearance | Lyophilized powder |
| Storage Buffer | PBS, pH7.4 |
| Reconstitution | Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation. |
| Stability & Storage | · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃. · 3 months, -20 to -80℃ under sterile conditions after reconstitution. · 1 week, 2 to 8℃ under sterile conditions after reconstitution. · Please avoid repeated freeze-thaw cycles. |
| Reference | 1. Comparative Study Protein Expr Purif . 1998 Mar;12(2):239-48. |
Background
Interleukin-13 is a cytokine which is secreted by activated T lymphocytes and primarily impacts monocytes, macrophages, and B cells. Interleukin 13 is a single-chain glycosylated polypeptide, which belongs to the IL-13/IL-4 family. IL-13 induces its effects through a multi-subunit receptor that includes the alpha chain of the IL-4 receptor (IL-4Rα) and at least one of two known IL-13-specific binding chains. Recent studies have shown that human interleukin-13 has many structural similarities with human interleukin-4 and is produced by gene replication events. As a cytokine, IL-13 protein is critical in regulating inflammatory, immune responses, and diseases.Also, it inhibits the production of pro-inflammatory cytokines and chemokines, and thus down-regulates macrophage activity.
Shipping Notes
- Free Standard Shipping on $100+ Orders to the USA.
- Except Preorder products are shipped in 48 hours.
- Delivery to the USA:
- Standard Shipping : 3-10 business days
- If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
- We offer a 30-day return/exchange service after receiving.
- Final sale items are not eligible for returns or exchanges.
- To process your return/exchange, please contact us at [email protected]
- Please click here for more details>>> Return & Exchange Policy