SKU: 53196529263

Human CD326 EPCAM, His tag

Sale price$130.50 Regular price$145.00
Save 10%

Pay in installments of $36.25 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 25 - Aug 30

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human CD326 EPCAM, His tagProduct Specification Species Human Synonyms Adenocarcinoma associated antigen, Cell surface glycoprotein Trop 1, Epithelial cell surface antigen, Epithelial glycoprotein (EGP), Epithelial glycoprotein 314 (EGP314; hEGP314), KS 1 4 antigen, KSA, Major gastrointestinal tumor associated protein GA733 2, Tumor associated calcium signal transducer 1, Ep CAM, GA733 2, M1S2, M4S1, MIC18, TACSTD1, TROP1 Accession P16422 Amino Acid Sequence Protein sequence

Product Specification


Species Human
Synonyms Adenocarcinoma-associated antigen, Cell surface glycoprotein Trop-1, Epithelial cell surface antigen, Epithelial glycoprotein (EGP), Epithelial glycoprotein 314 (EGP314; hEGP314), KS 1/4 antigen, KSA, Major gastrointestinal tumor-associated protein GA733-2, Tumor-associated calcium signal transducer 1, Ep-CAM, GA733-2, M1S2, M4S1, MIC18, TACSTD1, TROP1
Accession P16422
Amino Acid Sequence

Protein sequence (P16422, Gln24-Lys265, with C-10*His) QEECVCENYKLAVNCFVNNNRQCQCTSVGAQNTVICSKLAAKCLVMKAEMNGSKLGRRAKPEGALQNNDGLYDPDCDESGLFKAKQCNGTSMCWCVNTAGVRRTDKDTEITCSERVRTYWIIIELKHKAREKPYDSKSLRTALQKEITTRYQLDPKFITSILYENNVITIDLVQNSSQKTQNDVDIADVAYYFEKDVKGESLFHSKKMDLTVNGEQLDLDPGQTLIYYVDEKAPEFSMQGLKGGGGSHHHHHHHHHH

Expression System CHO
Molecular Weight Predicted MW: 29.1 kDa Observed MW: 33 kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Tag with C-10*His
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

Epithelial cell adhesion molecule (EpCAM) is a transmembrane glycoprotein mediating Ca2+-independent homotypic cell–cell adhesion in epithelia. EpCAM is also involved in cell signaling, migration, proliferation, and differentiation. Additionally, EpCAM has oncogenic potential via its capacity to upregulate c-myc, e-fabp, and cyclins A & E. Since EpCAM is expressed exclusively in epithelia and epithelial-derived neoplasms, EpCAM can be used as diagnostic marker for various cancers. It appears to play a role in tumorigenesis and metastasis of carcinomas, so it can also act as a potential prognostic marker and as a potential target for immunotherapeutic strategies. EpCAM is often overexpressed in certain carcinomas, including in breast cancer, colon cancer and basal cell carcinoma of the skin. A problem in EpCAM can indirectly cause Lynch syndrome, a genetic disorder that leads to increased risk of cancer. Mutations in EpCAM have also been associated with congenital tufting enteropathy which causes intractable diarrhea in newborn children.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 53196529263

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.2 ★★★★★
Based on 9 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
C
Verified Purchase
Couchguard
Whiting, US
★★★★★ 5
Smells great!!
Size: 16 Fl Oz (Pack of 1)
This is great shampoo. I'm not convinced of the thickening qualities but I'm 50+ and still have plenty of hair. This stuff smells great and gets the job done! I like that it's 16 ounces, others come in 8 oz bottles and last about a month or so, so this size is much better. I feel like it gets my hair clean and lathers up very well. I would buy again!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on November 24, 2025
D
Verified Purchase
DandyDave
Dallas, US
★★★★★ 5
Great value, more body, clean hair.
Size: 16 Fl Oz (Pack of 1)
Works great, a little goes a long way. Just enough scent not overpowering, cleans well and rinses easily.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 4, 2026
W
Verified Purchase
Whitney Hays
Draper, US
★★★★★ 5
For dry pits, this is it!
Style: Casked Vanilla, Size: 2.65 Ounce (Pack of 1)
This stuff works great. I used to use the Dove Men+ but they changed the formula and it did not work as well for me This formula (aluminum zirconium tetrachlorohydrex gly) works phenomenally keeping the under arms dry and the Casked Vanilla is a nice, long lasting scent. Easily lasts all day and still smells fresh after 36-ish hours. I have not experienced any irritation. Glad I found this product!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 26, 2026
J
Verified Purchase
James
Lowell, US
★★★★★ 5
Strong scent, strong protection
Style: Italian Bergamot, Size: 2.65 Ounce (Pack of 1)
I’ve been using Cremo Deodorant for Men with the 48‑hour sweat and odor protection, and it does a genuinely good job of keeping me dry and fresh through a normal workday and into the evening. The formula goes on smoothly without tugging, feels comfortable on the skin, and I haven’t noticed irritation or marks on my shirts, which is a big plus if you wear darker colors. The scent is classic Cremo: richer and more layered than a typical drugstore stick, so you get a more “cologne‑like” vibe rather than a basic soapy smell. In terms of performance, it holds up really well for office, errands, and casual activity, and you only really start to notice it fading after a long, hot day or heavier workouts. If you run very hot or do intense outdoor work, you might want to reapply or pair it with a body spray, but for most day‑to‑day situations the protection is more than enough. Overall, if you like bolder, sophisticated scents and want something that feels a step up from basic antiperspirants without complicating your routine, this stick is easy to recommend.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 5, 2026
M
Verified Purchase
Mitch F
Omaha, US
★★★★★ 5
Smells Incredible and Actually Works!
Style: Palo Santo, Size: 2.65 Ounce (Pack of 1)
’ve tried a lot of men’s deodorants over the years, but this one from Cremo — Palo Santo Antiperspirant & Deodorant — really stands out. The scent is next-level: smooth, woodsy, and just a little bit exotic without being overpowering. It smells high-end, almost like a cologne you’d pay good money for. Performance-wise, it absolutely delivers. I stay dry and fresh all day, even through long work hours and workouts. The 48-hour protection claim actually holds up — I’ve gone a full day and into the next morning without any trace of odor or stickiness. It also goes on smoothly, doesn’t leave white marks on dark shirts, and doesn’t have that waxy or powdery feel some antiperspirants do. The packaging feels premium too, which fits the Cremo brand. Bottom line: If you want a deodorant that smells incredible and actually performs like it says it will, this one’s worth every penny. Palo Santo is now my go-to scent — masculine, clean, and unique.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on October 25, 2025

recommand products