Pay in installments of $130.00 with
,
and
Shipping Estimate
USA
- USA
- CAN
- USA
- CAN
Ships within 48 hours · Estimated delivery Aug 26 - Aug 31
Promo Codes Available:
For Your Every Summer RSVP, with Code: SUMMER15
Description
TIMP1 Fc Chimera Protein, HumanProduct Specification Species Human Synonyms TIMP1, CLGI, TIMP Accession P01033 Amino Acid Sequence Cys24 Ala207, with N terminal Human IgG1 Fc
Product Specification
| Species | Human |
| Synonyms | TIMP1, CLGI, TIMP |
| Accession | P01033 |
| Amino Acid Sequence | Cys24-Ala207, with N-terminal Human IgG1 Fc DKTHTSPPSPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKGGGSGGGSGGGSGGGSGGGSDDDDKCTCVPPHPQTAFCNSDLVIRAKFVGTPEVNQTTLYQRYEIKMTKMYKGFQALGDAADIRFVYTPAMESVCGYFHRSHNRSEEFLIAGKLQDGLLHITTCSFVAPWNSLSLAQRRGFTKTYTVGCEECTVFPCLSIPCKLQSGTHCLWTDQLLQGSEKGFQSRHLACLPREPGLCTWQSLRSQIA |
| Expression System | HEK293 |
| Molecular Weight | 55-65kDa |
| Purity | >95% by SDS-PAGE |
| Endotoxin | <0.1EU/μg |
| Conjugation | Unconjugated |
| Physical Appearance | Lyophilized Powder |
| Storage Buffer | PBS, pH7.4 |
| Reconstitution | Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation. |
| Stability & Storage | · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃. · 3 months, -20 to -80℃ under sterile conditions after reconstitution. · 1 week, 2 to 8℃ under sterile conditions after reconstitution. · Please avoid repeated freeze-thaw cycles. |
| Reference |
1、Hornebeck W. (2004) Down-regulation of tissue inhibitor of matrix metalloprotease-1 (TIMP-1) in aged human skin contributes to matrix degradation and impaired cell growth and survival. Pathol Biol. 51(10): 569-573. 2、Soini Y. et al. (2001) Expression of MMP2, MMP9, MT1-MMP, TIMP-1, and TIMP2 mRNA in valvular lesions of the heart. J Pathol. 194(2): 225-231. |
Background
TIMP metallopeptidase inhibitor 1 is also known as TIMP1, a tissue inhibitor of metalloproteinases, is a glycoprotein that is expressed from the several tissues of organisms. TIMP1 is a glycoprotein with a molecular mass of 28 kDa produced by a wide range of cell types. Tissue inhibitor matrix metalloproteinase 1 (TIMP1), which belongs to TIMP gene family, is a natural inhibitor of the matrix metalloproteinases (MMPs). Tissue inhibitor of metalloproteinases 1 (TIMP1) was the secreted factor with the strongest male-biased expression in patient-derived pancreatic tumors. Male-specific up-regulation of systemic TIMP1 was demonstrated in PC mouse models and patients. Using TIMP1-competent and TIMP1-deficient PC mouse models, we established a causal role of TIMP1 in determining shortened survival and increased liver metastasis in males.
Shipping Notes
- Free Standard Shipping on $100+ Orders to the USA.
- Except Preorder products are shipped in 48 hours.
- Delivery to the USA:
- Standard Shipping : 3-10 business days
- If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
- We offer a 30-day return/exchange service after receiving.
- Final sale items are not eligible for returns or exchanges.
- To process your return/exchange, please contact us at [email protected]
- Please click here for more details>>> Return & Exchange Policy
4.9 ★★★★★
Based on 16 reviews
Sort
Product Reviews
★★★★★ 5
I LOVE this sunscreen!! Super affordable and lightweight for your skin!
Size: 6 Fl Oz (Pack of 1), Style: SPF 50
I love this sunscreen!! Love it so much I bought 3 bottles of it!
Super lightweight and blends right into the skin, and I don’t feel not sticky!
I got super excited and got this primarily because it’s lightweight, super affordable, SPF 50 for high protection, and it said there’s no alcohol or fragrance…heres the catch tho, there IS a slight sunscreen smell, but you only notice it when applying it and if you keeping smelling it on yourself up close during the day.
Other than that, it’s truly fragrance free in the sense that you aren’t just standing there doing your thing, and keep getting HIT with the scent of sunscreen for hours, like other sunscreens! The scent is extremely light and pleasant when you go to smell it on yourself.
Don’t EVER discontinue this please please please!!!!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 26, 2026
★★★★★ 5
It’s great! So light weight!
Size: 3 Fl Oz (Pack of 1), Style: SPF 50
I have been testing this out for a month now.
I love it. This does have avobenzone in it, and because of that, I do NOT put it around my eyes as avobenzone is a chemical sunscreen ingredient that typically tends to cause the of sensation of burning eyes! At least for me it does.
I use an Australian sunscreen around my eyes that doesn’t have anything that irritates my eyes. So for the rest of my face, this stuff is great. It literally is so serum like sinks into your skin within five minutes or sooner. Now it’s not the most hydrating thing in the world so if you have a dry skin, you still wanna go in with a moisturizer before however, if you have oily skin, this is your girl right here. Skin like finish, not super matte and not dewy at all. I do not wear primer so I don’t know how it plays with that. Works great under my makeup and has never caused pilling.
Quick, easy, simple ingredients, definitely sensitive skin friendly, and no fragrance at an affordable cost-effective price! Now if only banana boat decided to go cruelty free😭
9/10 bc not CF 💔
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 27, 2026
★★★★★ 5
Great sensitive skin sunscreen
Size: 3 Fl Oz (Pack of 1), Style: SPF 50
Love this! I have sensitive skin. this did not sting my eyes, or burn my cheeks. Left no white cast. I'm not noticing any scent. It just feels like bare skin, it's not heavy, drying, oily or sticky. No pilling. Went on smooth, not streaky, looks like skin once dried down, not patchy. I hope they keep this in stock forever!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 27, 2026
★★★★★ 5
Lightweight and Effective
Style: SPF 70, Size: 8 Fl Oz (Pack of 1)
I love how lightweight and comfortable this sunscreen feels on my skin. The appearance leaves a nice glow without looking greasy or heavy. The bottle size lasts a long time and it’s very easy to apply evenly. It also smells amazing compared to other sunscreens. Definitely worth the money and perfect for everyday use.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 20, 2026
★★★★★ 5
Good!
Style: SPF 70, Size: 8 Fl Oz (Pack of 1)
Works well! Love the subtle shimmer and glow it gives me. Doesn’t leave a white cast, but definitely does feel a little oily on the skin. Smells very nice too, not that classic chemical sunscreen smell at all.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 23, 2026