Pay in installments of $33.75 with
,
and
Shipping Estimate
USA
- USA
- CAN
- USA
- CAN
Ships within 48 hours · Estimated delivery Sep 2 - Sep 7
Promo Codes Available:
For Your Every Summer RSVP, with Code: SUMMER15
Description
Epididymis Protein 4(HE4) His Tag Protein, HumanProduct Specification Species Human Synonyms Epididymis 4(HE4); WAP Four Disulfide Core Domain Protein 2, Epididymal Secretory Protein E4, Major Epididymis Specific Protein E4, Putative Protease Inhibitor WAP5, WFDC2, HE4, WAP5 Accession Q14508 Amino Acid Sequence EKTGVCPELQADQNCTQECVSDSECADNLKCCSAGCATFCSLPNDKEGSCPQVNINFPQLGLCRDQCQVDSQCPGQMKCCRNGCGKVSCVTPNFHHHHHH Expression System HEK293 Molecular Weight major bands at 19 kDa and 22 26 kDa
Product Specification
| Species | Human |
| Synonyms | Epididymis 4(HE4);WAP Four-Disulfide Core Domain Protein 2, Epididymal Secretory Protein E4, Major Epididymis-Specific Protein E4, Putative Protease Inhibitor WAP5, WFDC2, HE4, WAP5 |
| Accession | Q14508 |
| Amino Acid Sequence | EKTGVCPELQADQNCTQECVSDSECADNLKCCSAGCATFCSLPNDKEGSCPQVNINFPQLGLCRDQCQVDSQCPGQMKCCRNGCGKVSCVTPNFHHHHHH |
| Expression System | HEK293 |
| Molecular Weight | major bands at 19 kDa and 22-26 kDa respectively which are due to post-translational modifications. |
| Purity | ＞95%, by SDS-PAGE under reducing conditions |
| Endotoxin | <2EU/μg |
| Conjugation | Unconjugated |
| Tag | His Tag |
| Physical Appearance | Lyophilized Powder |
| Storage Buffer | PBS, pH7.4 |
| Reconstitution | Reconstitute at less than 1 mg/mL according to the size in ultrapure water after rapid centrifugation . |
| Stability & Storage | · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃. · 3 months, -20 to -80℃ under sterile conditions after reconstitution. · 1 week, 2 to 8℃ under sterile conditions after reconstitution. · Please avoid repeated freeze-thaw cycles. |
Background
Human epididymal protein 4 (HE4) belongs to the whey acidic 4-disulfide center (WFDC) protein family and has the characteristics of suspected trypsin inhibitors. Mature human HE4 contains 94 amino acids (aa) and consists of two core structures: a natural N-terminal glycosylated protein of about 25KDa and two core regions of whey acidic protein (WAP, which consists of four disulfide core regions and eight cysteine residues). WFDC2 / HE4 can undergo a series of complex alternative splicing events and may produce five different protein subtypes containing WAP domains. It is expressed in many normal tissues, including the male reproductive system, respiratory region and nasopharynx. It is highly expressed in ovarian, colon, breast, lung, kidney and other tumor cell lines.
Shipping Notes
- Free Standard Shipping on $100+ Orders to the USA.
- Except Preorder products are shipped in 48 hours.
- Delivery to the USA:
- Standard Shipping : 3-10 business days
- If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
- We offer a 30-day return/exchange service after receiving.
- Final sale items are not eligible for returns or exchanges.
- To process your return/exchange, please contact us at [email protected]
- Please click here for more details>>> Return & Exchange Policy