SKU: 55206550169

Human IL-13, His tag

Sale price$153.00 Regular price$170.00
Save 10%

Pay in installments of $42.50 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 26 - Aug 31

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human IL-13, His tagProduct Specification Species Human Synonyms NC30 Accession P35225 Amino Acid Sequence Protein sequence (P35225, Gly35 Asn146, with C 10*His) GPVPPSTALRELIEELVNITQNQKAPLCNGSMVWSINLTAGMYCAALESLINVSGCSAIEKTQRMLSGFCPHKVSAGQFSSLHVRDTKIEVAQFVKDLLLHLKKLFREGRFNGGGGSHHHHHHHHHH Expression System CHO Molecular Weight Predicted MW: 14 kDa Observed MW: 14, 25 35 kDa Purity 95% by SDS PAGE Endotoxin <1EU g Tag with C 10*His Physical Appearance Lyophilized Powder

Product Specification


Species Human
Synonyms NC30
Accession P35225
Amino Acid Sequence

Protein sequence (P35225, Gly35-Asn146, with C-10*His) GPVPPSTALRELIEELVNITQNQKAPLCNGSMVWSINLTAGMYCAALESLINVSGCSAIEKTQRMLSGFCPHKVSAGQFSSLHVRDTKIEVAQFVKDLLLHLKKLFREGRFNGGGGSHHHHHHHHHH

Expression System CHO
Molecular Weight Predicted MW: 14 kDa Observed MW: 14, 25-35 kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Tag with C-10*His
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/ml according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

Interleukin 13 (IL-13) is a protein that in humans is encoded by the IL13 gene. The secondary structural features of IL-13 are similar to that of Interleukin 4 (IL-4); however it only has 25% sequence identity to IL-4 and is capable of IL-4 independent signaling. IL-13 is a cytokine secreted by T helper type 2 (Th2) cells, CD4 cells, natural killer T cell, mast cells, basophils, eosinophils and nuocytes. Interleukin-13 is a central regulator in IgE synthesis, goblet cell hyperplasia, mucus hypersecretion, airway hyperresponsiveness, fibrosis and chitinase up-regulation. It is a mediator of allergic inflammation and different diseases including asthma.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 55206550169

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.6 ★★★★★
Based on 24 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
J
Verified Purchase
Julie B
Port Orchard, US
★★★★★ 5
Best textbook I've ever read, LOVE GEHART
Format: eTextbook
I used another Gehart textbook in a different class and I can't say enough how much I love this author. In 6 years of academia I don't think I've actually enjoyed reading a textbook until this. She has a "needs to know" section at the beginning of each chapter so even if I haven't had time to read the entire chapter before when I need to I can read that and have some basis of understanding. She also includes information on the theorists, and even though I always skip that part I know some people really like knowing about that. I think it is INVALUABLE that each chapter also has a sample case conceptualization and treatment plan template. AS WELL AS exploring the implications for each theory of its strength's and limitation's with working with diverse clients. My only very minor complaint is the Questions for Personal Reflection and Class Discussion. For several of the chapters it really seems like this was written by someone who hadn't even read the chapter because there were questions asking about something that was very minor or barely mentioned in the chapter.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 7, 2015
P
Verified Purchase
Pangie
Cuba, US
★★★★★ 5
one of the most helpful counseling books I've found
using this in my master's level counseling class and it's a great resource. I appreciate the way it is written/organized/formatted. It offers some historical background to the theory, describes the theoretical concepts and framework, gives a case example, a sort of worksheet/guide for applying it in practice, and cultural considerations for each chapter/theory.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 18, 2021
G
Verified Purchase
GoodGirl
Charlottesville, US
★★★★★ 5
Great w/ADHD
Format: Paperback
This book was highly recommended to me as graduate intern because I struggle to stay focused. This is an easy “get what you need” book of various modalities and provides you the ability to learn enough about the modalities in addition to applying the modality quick reference format. Would highly recommend for anyone that gets extremely overwhelmed learning modalities.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on July 28, 2023
C
Verified Purchase
C. C. Mom
Lake Worth, US
★★★★★ 5
I wish I had bought it the first semester of school
This is the most comprehensive treatment planning book I own. I wish I had bought it in my first semester of school. Gehart is a clear and engaging writer. The clinical vignettes are true-to-life. The theoretical summaries are priceless and will save you hours of confusing cross-referencing and reading. If you are involved in psychotherapy, clinical psychology, counseling or even a humanities scholar who is interested in theories of psychology, you should have this book on your reference shelf.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on October 26, 2015
C
Verified Purchase
Chris Adkins
Bozeman, US
★★★★★ 4
Foundational
This is a great foundational book for new and aspiring counselors. This book looks at each of the major theories of treatment that are fundamemtal to being a successful counselor. A must read for students or interns.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on August 14, 2024

recommand products