SKU: 55353768097

Rabbit IgG lambda, his tag

Sale price$90.00 Regular price$100.00
Save 10%

Pay in installments of $25.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 30 - Sep 4

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Rabbit IgG lambda, his tagProduct Specification Species Rabbit Amino Acid Sequence Protein sequence (with C 10*His) QPAVTPSVILFPPSSEELKDNKATLVCLINDFYPGTVKVNWKADGTPVTQGVDTTQPSKQSNSKYAASSFLSLSANQWKSYQSVTCQVTHEGHTVEKSLAPAECSGGGGSHHHHHHHHHH Expression System HEK293 Molecular Weight Predicted MW: 13. 0 kDa Observed MW: 17. 0 kDa Purity 95% by SDS PAGE Tag with C 10*His Physical Appearance Lyophilized Powder Storage Buffer Lyophilized from a 0. 2 m filtered solution of 0. 2M PBS,

Product Specification


Species Rabbit
Amino Acid Sequence

Protein sequence (with C-10*His) QPAVTPSVILFPPSSEELKDNKATLVCLINDFYPGTVKVNWKADGTPVTQGVDTTQPSKQSNSKYAASSFLSLSANQWKSYQSVTCQVTHEGHTVEKSLAPAECSGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Predicted MW: 13.0 kDa Observed MW: 17.0 kDa
Purity >95% by SDS-PAGE
Tag with C-10*His
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

Immunoglobulin G (IgG) is a type of antibody. Representing approximately 75% of serum antibodies in humans, IgG is the most common type of antibody found in blood circulation. IgG molecules are created and released by plasma B cells. Lambda light chains are one of the two classes of light chains present on mammalian immunoglobulins. They are found in combination with kappa light chains. These chains are usually present in a 70:30 ratio of kappa to lambda. Anti-lambda light chain antibodies can nonspecifically bind to multiple isotypes of immunoglobulins.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 55353768097

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.2 ★★★★★
Based on 12 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
G
Verified Purchase
Gabby Powell
Charlottesville, US
★★★★★ 5
Would buy again!
Color: Natural Wood, Size: 13.2inch(2PCS)
These were the perfect addition to our empty corner in our kitchen. Very sturdy and durable. Easy to install. Comes with mounting hardware.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 23, 2026
A
Verified Purchase
Anne Erwin
Draper, US
★★★★★ 5
Beautiful shelves!
Color: Dark Walnut, Size: 8.5inch(2PCS)
Exactly what I needed! Very easy to install and looks great! Great value for the money.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 19, 2026
R
Verified Purchase
ron shaffer
Battle Creek, US
★★★★★ 5
Great value
Color: Natural Wood, Size: 8.5inch(2PCS)
Excellent, solid built shelves. Comes with every type of fastener you could possibly need to install. Even comes with a small level. Very impressed with it all and highly recommend.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 24, 2026
D
Verified Purchase
D.O.
Alexandria, US
★★★★★ 4
Nice shelf, install a bit problematic
Color: Dark Walnut, Size: 8.5inch(2PCS)
Nice little shelf, looks great, feels stable enough for my small accent lamp. Two issues: 1. The cutout in the corner is perfect for a cord >>>BUT<<< the plug itself CANNOT fit though that hole. You have to feed the cord through BEFORE INSTALL. So once it’s in, it’s IN. 2. Install seems pretty straight forward but it was not so easy! The rails are too thick for a pencil to go through the screw hole to mark placement. I had to physically hold everything in place and leveled WHILE I drilled. Rather annoying.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 12, 2026
A
Verified Purchase
Amazon Customer
Battle Creek, US
★★★★★ 5
Great item!
Color: Natural Wood, Size: 8.5inch(2PCS)
These shelves were great! I put them in the bathroom and helped with added space for holding candle and items to help keep counter clear.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 9, 2026

recommand products