SKU: 56511678995

MERTK His Tag Protein, Mouse

Sale price$271.80 Regular price$302.00
Save 10%

Pay in installments of $75.50 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 27 - Sep 1

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

MERTK His Tag Protein, MouseProduct Specification Species Mouse Synonyms MER, STK Kinase, Tyro12, C Eyk, C Mer, RP38 Accession Q60805 Amino Acid Sequence Gly19 Met497, with C terminal 8*His

Product Specification


Species Mouse
Synonyms MER, STK Kinase, Tyro12, C-Eyk, C-Mer, RP38
Accession Q60805
Amino Acid Sequence

Gly19-Met497, with C-terminal 8*His GGTAEKWEETELDQLFSGPLPGRLPVNHRPFSAPHSSRDQLPPPQTGRSHPAHTAAPQVTSTASKLLPPVAFNHTIGHIVLSEHKNVKFNCSINIPNTYQETAGISWWKDGKELLGAHHSITQFYPDEEGVSIIALFSIASVQRSDNGSYFCKMKVNNREIVSDPIYVEVQGLPYFIKQPESVNVTRNTAFNLTCQAVGPPEPVNIFWVQNSSRVNEKPERSPSVLTVPGLTETAVFSCEAHNDKGLTVSKGVHINIKVIPSPPTEVHILNSTAHSILVSWVPGFDGYSPLQNCSIQVKEADRLSNGSVMVFNTSASPHLYEIQQLQALANYSIAVSCRNEIGWSAVSPWILASTTEGAPSVAPLNITVFLNESNNILDIRWTKPPIKRQDGELVGYRISHVWESAGTYKELSEEVSQNGSWAQIPVQIHNATCTVRIAAITKGGIGPFSEPVNIIIPEHSKVDYAPSSTPAPGNTDSMGGGSHHHHHHHH

Expression System HEK293
Molecular Weight 80-110kDa
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1.Graham, D.K. et al. (1994) Cell Growth Differ. 5:647.

2.Graham, D.K. et al. (2006) Clin. Cancer Res. 12:2662.

Background

Tyrosine-protein Kinase Mer, also known as c-Mer and MerTK, is a member of the receptor tyrosine kinase subfamily TAM (Tyro3, Axl, and Mer). Similar to Axl and Tyro3, the extracelluar domain of Mer contains two Ig-like motifs and two fibronectin type III motifs. Mer is not expressed in normal B- and T-cells but expressed in neoplastic B- and T-cell lines . It is also show higher expression in immunosuppressive M2‑like macrophages. Following activation by ligand, interacts with GRB2 or PLCG2 and induces phosphorylation of MAPK1, MAPK2, FAK/PTK2 or RAC1. MERTK signaling plays a role in various processes such as macrophage clearance of apoptotic cells, platelet aggregation, cytoskeleton reorganization and engulfment. Functions in the retinal pigment epithelium (RPE) as a regulator of rod outer segments fragments phagocytosis. Plays also an important role in inhibition of Toll-like receptors (TLRs)-mediated innate immune response by activating STAT1, which selectively induces production of suppressors of cytokine signaling SOCS1 and SOCS3.Mer is known to bind Gas6, Protein S, Tubby, Tubby-like protein 1 (Tulp1), and Galectin-3. Upon binding ligands via the Ig-like motif, Mer is dimerized to trans-autophosphorylate the kinase domain to induce downstream signaling. It has been shown that Mer signaling in macrophages induces M2 polarization, which promote tumor growth, metastasis and evasion of anti-tumor immunity in tumor microenviroment. Inhibition of Mer, especially on leukocytes and macrophages, is an effective anti-cancer therapy.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 56511678995

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.1 ★★★★★
Based on 9 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
C
Verified Purchase
Christmas Gift
Lowell, US
★★★★★ 3
Wobbly
Color: Grey
Wobbly and the metal bars keep coming off. Be aware. I’ve tripped over them. Be careful.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 21, 2026
A
Verified Purchase
Amazon Customer
Port Orchard, US
★★★★★ 5
Very practical for the price.
Color: Black
Very practical for the price.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 25, 2026
J
Jeni & Mark
Birmingham, US
★★★★★ 4
Good for a quick backdrop
This works well for what I needed – a simple background for my kids’ online school. It’s lightweight and very easy to put together, and it stands up fine without needing to mount anything. The color is listed as black, but it’s more of a dark gray in person. Not a huge deal, just something to be aware of. It’s not super heavy duty, but it does the job for privacy and as a video backdrop. Overall, a good, portable divider that’s quick to set up and works well for light use.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 21, 2026
R
Verified Purchase
Robert A. Bertsche
Alexandria, US
★★★★★ 5
Essay to assemble
Color: Grey
Very nice. Did the job the way I wanted.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 28, 2026
K
Verified Purchase
Kevin
Whiting, US
★★★★★ 2
Low budget option
Color: Grey
Budget low quality if thats what youre looking for
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 27, 2026

recommand products