SKU: 57177759171

LILRA3 His Tag Protein, Human

Sale price$306.00 Regular price$340.00
Save 10%

Pay in installments of $85.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 30 - Sep 4

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

LILRA3 His Tag Protein, HumanProduct Specification Species Human Synonyms Leukocyte immunoglobulin like receptor subfamily A member 3 Accession Q8N6C8 Amino Acid Sequence Gly24 Glu439, with C terminal 8*His

Product Specification


Species Human
Synonyms Leukocyte immunoglobulin-like receptor subfamily A member 3
Accession Q8N6C8
Amino Acid Sequence Gly24-Glu439, with C-terminal 8*His GPLPKPTLWAEPGSVITQGSPVTLRCQGSLETQEYHLYREKKTALWITRIPQELVKKGQFPILSITWEHAGRYCCIYGSHTAGLSESSDPLELVVTGAYSKPTLSALPSPVVTSGGNVTIQCDSQVAFDGFILCKEGEDEHPQCLNSHSHARGSSRAIFSVGPVSPSRRWSYRCYGYDSRAPYVWSLPSDLLGLLVPGVSKKPSLSVQPGPVVAPGEKLTFQCGSDAGYDRFVLYKEWGRDFLQRPGRQPQAGLSQANFTLGPVSRSYGGQYTCSGAYNLSSEWSAPSDPLDILITGQIRARPFLSVRPGPTVASGENVTLLCQSQGGMHTFLLTKEGAADSPLRLKSKRQSHKYQAEFPMSPVTSAHAGTYRCYGSLSSNPYLLTHPSDPLELVVSGAAETLSPPQNKSDSKAGEGGGSHHHHHHHH
Expression System HEK293
Molecular Weight 68-75kDa (Reducing)
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.

Background

Leukocyte immunoglobulin-like receptor subfamily A member 3 (LILRA3) is also known as CD85 antigen-like family member E (CD85e), immunoglobulin-like transcript 6 (ILT-6) belongs to a family of leucocyte receptors. LILRA3 lacks a transmembrane domain and it is highly homologous to other LILR genes, and can bind human leukocyte antigen (HLA) class I. The biologic role of the LILRA3 molecule and the nature of its ligand are not known. LILRA3 can bind with high affinity to the surface of monocytes, leading to abolish LPS-induced TNF-alpha production by monocytes. It can be detected in B-cells, natural killer (NK) cells, peripheral blood monocytes and lung. LILRA3 transcripts are markedly upregulated in neutrophils from patients with antiphospholipid syndrome (APS). Some polymorphisms of the LILR genes are reported to be associated with susceptibility to diseases such as rheumatoid arthritis and multiple sclerosis.
Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 57177759171

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.6 ★★★★★
Based on 18 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
K
Verified Purchase
Ksett
Omaha, US
★★★★★ 5
Excellent dog chew
Size: Small (Pack of 1)
Our dog loves this and uses it everyday. Still going strong 3 months later.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 11, 2026
M
Verified Purchase
Mike c
Charlottesville, US
★★★★★ 5
My 2 German shepherds love these good quality last a good bit
Size: Large (Pack of 1)
I buy these for my 2 German shepherds. My male is a heavy chewer and he will spend time with this everyday until he starts to wear it down or makes it into a makeshift shank and I replace it Last about 3-4 months for aggressive chewers. Highly recommend (keeps them from chewing my stuff)
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 1, 2026
R
Verified Purchase
Reviewer 22
Omaha, US
★★★★★ 5
The best bone you can get for pitbulls!
Size: Large (Pack of 1)
Can I give these more than five stars? Please?? They truly deserve more than that! I have bought these bones for the last 2 years for my pitbull mix, who is a very aggressive chewer. Her favorite thing to do is just lay and chew. These bones last FOREVER! She can lay there and chew all day long and they will last her MONTHS! It’s honestly amazing! These are the best bones we’ve ever given her and they are the only ones we’ll buy her! Not only do they last forever, they’re safe and natural too! Best product ever!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 10, 2026
D
Verified Purchase
Dee
Massapequa, US
★★★★★ 4
Great for aggressive chewers, but small mess
Size: Large (Pack of 1), Size: Large (Pack of 1)
He took it right away! It’s a great size. We’ll see how it holds up ONE MONTH UPDATE: (photo included) He loves it still! Still a bit messy but holding up great and he’s a aggressive chewer 1 WEEK UPDATE (photo update included) The bone is great. He loves it and it’s been holding up great. Our 8 month puppy is a super chewer and 60 lbs. the bone has signs of wear but nothing crazy. I went from 5 stars to 4 stars because whenever he chews the bone, the small tiny pieces of bone/wood go everywhere and they’re sticky/hard and make kind of a mess. But still would get this bone again and highly recommend
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 16, 2025
H
Verified Purchase
hellothere
Battle Creek, US
★★★★★ 5
Dog loves these
Size: X-Small (Pack of 1)
These are the best chew toys. They are reasonably priced and last a long while. Fast shipping.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 8, 2026

recommand products