SKU: 57386578826

CD34 Fc Chimera Protein, Mouse

Sale price$271.80 Regular price$302.00
Save 10%

Pay in installments of $75.50 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Sep 1 - Sep 6

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

CD34 Fc Chimera Protein, MouseProduct Specification Species Mouse Antigen CD34 Synonyms RP11 328D5. 2, CD34 molecule, HPCA1 Accession Q64314 1 Amino Acid Sequence Thr35 Thr287, with C terminal Human IgG Fc

Product Specification


Species Mouse
Antigen CD34
Synonyms RP11-328D5.2, CD34 molecule, HPCA1
Accession Q64314-1
Amino Acid Sequence

Thr35-Thr287, with C-terminal Human IgG Fc TTETSTQGISPSVPTNESVEENITSSIPGSTSHYLIYQDSSKTTPAISETMVNFTVTSGIPSGSGTPHTFSQPQTSPTGILPTTSDSISTSEMTWKSSLPSINVSDYSPNNSSFEMTSPTEPYAYTSSSAPSAIKGEIKCSGIREVRLAQGICLELSEASSCEEFKKEKGEDLIQILCEKEEAEADAGASVCSLLLAQSEVRPECLLMVLANSTELPSKLQLMEKHQSDLRKLGIQSFNKQDIGSHQSYSRKTIEGRMDPKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

Expression System HEK293
Molecular Weight 72-95kDa
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag Human Fc Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1. Laura E Sidney, Matthew J Branch, Siobhán E Dunphy, Harminder S Dua,and Andrew Hopkinson. Concise Review: Evidence for CD34 as a Common Marker for Diverse Progenitors. Stem Cells. 2014 Jun; 32(6): 1380-1389.Published online 2014 May 23.

Background

CD34 is predominantly regarded as a marker of hematopoietic stem cells (HSC) and hematopoietic progenitor cells. However, CD34 is now also established as a marker of several other nonhematopoietic cell types, including vascular endothelial progenitors and embryonic fibroblasts. Accumulating evidence demonstrates CD34 expression on several other cell types, including multipotent mesenchymal stromal cells (MSC), interstitial dendritic cells, and epithelial progenitors, but there remains limited recognition of the role of CD34-positive (CD34+) cells outside of each individual specialty.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 57386578826

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.6 ★★★★★
Based on 13 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
G
Verified Purchase
Geddes J
Birmingham, US
★★★★★ 4
Good History Book
Format: Kindle
Twenty years that change history and the Americas. Even though the civil war ended slavery at a humongous cost, it it failed to bring social justice a d civil rights to the population of the country. It was not until 1920 that women were granted voting rights. And some problems and divisions persist nowdays.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on July 2, 2024
I
Verified Purchase
Ian R
Waukegan, US
★★★★★ 5
interesting and fresh perspective on the American civil war
Format: Kindle
Fresh perspective on the well known American Civil War. I appreciate Dr Taylor’s emphasis on the preservation of slavery over the states’ rights argument for why the American Civil War was fought.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 1, 2024
T
Verified Purchase
Tony Abbott
Carnegie, US
★★★★★ 5
Good oil
Size: 5 Quarts
I have used Castrol GTX/edge for 40 years, works well, never wanted to change, good price.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 30, 2026
E
Verified Purchase
Edmond Ilunga Kaninda
Grantham, US
★★★★★ 5
Excellent engine oil
Size: 5 Quarts, Size: 5 Quarts
This is the best oil that I ever used.I have used it in my Toyota Noah 2006-2007 model…The engine is as quiet as new…wanted to see how it would perform.It has clocked 3,500km.This is good and have recommended to my friends and family
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 23, 2026
D
Verified Purchase
Dawn S.
Cuba, US
★★★★★ 5
Top-tier engine protection that runs quiet and smooth
Size: 5 Quarts
I’ve used Castrol EDGE in a couple of our vehicles and always come back to it for consistent performance. It extends the time between oil changes and holds up well under both daily driving and highway mileage. We don't "extend the time" though. It's changed, on the dot, every time. The consistency and quality of the oil's condition at change, though, is easily able to be seen that it would go for much longer. Engine runs quieter, and I’ve noticed better fuel efficiency over time compared to conventional oil. Whether that's how attentively I drive and watch the mileage meter on the dash or the oil - is up for debate ;) It doesn’t burn off as quickly either, which is great if you’re keeping an eye on long-term engine health. The bottle design pours cleanly with a smart spout, which saves unnecessary messes in the garage. Pros: Strong wear protection and long-lasting Improves engine quietness Easy-pour design Tip: Use it with a high-quality oil filter for maximum benefit don’t skimp on either part and you'll be golden.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 26, 2025

recommand products