SKU: 57609366624

Human CBP, His tag

Sale price$144.00 Regular price$160.00
Save 10%

Pay in installments of $40.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 26 - Aug 31

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human CBP, His tagProduct Specification Species Human Synonyms CREB binding protein, Histone lysine acetyltransferase CREBBP, Protein lysine acetyltransferase CREBBP, CREBBP, CBP Accession Q92793 Amino Acid Sequence Protein sequence (Q92793, Thr144 Ser417, with C 10*His)

Product Specification


Species Human
Synonyms CREB-binding protein, Histone lysine acetyltransferase CREBBP, Protein-lysine acetyltransferase CREBBP, CREBBP, CBP
Accession Q92793
Amino Acid Sequence

Protein sequence (Q92793, Thr144-Ser417, with C-10*His) TPAASQALNPQAQKQVGLATSSPATSQTGPGICMNANFNQTHPGLLNSNSGHSLINQASQGQAQVMNGSLGAAGRGRGAGMPYPTPAMQGASSSVLAETLTQVSPQMTGHAGLNTAQAGGMAKMGITGNTSPFGQPFSQAGGQPMGATGVNPQLASKQSMVNSLPTFPTDIKNTSVTNVPNMSQMQTSVGIVPTQAIATGPTADPEKRKLIQQQLVLLLHAHKCQRREQANGEVRACSLPHCRTMKNVLNHMTHCQAGKACQVAHCASSRQIISGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Predicted MW: 29.9 kDa Observed MW: 43-90 kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Tag with C-10*His
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

CREB-binding protein, also known as CREBBP or CBP or KAT3A, is a coactivator encoded by the CREBBP gene in humans. CBP has intrinsic acetyltransferase functions; it is able to add acetyl groups to both transcription factors as well as histone lysines, the latter of which has been shown to alter chromatin structure making genes more accessible for transcription. CBP alone has been implicated in a wide variety of pathophysiologies including colorectal cancer as well as head and neck squamous cell carcinoma. In these diseases, association of CBP with β-catenin has been shown to promote cancer cell proliferation and disease aggressiveness, whereas p300/ β-catenin leads to cell differentiation and/ or apoptosis. CBP has also been shown to help modulate liver function via maintenance of energy homeostasis in response to changes in cell nutrition conditions by regulating the activity of transcription factors and genes responsible for lipogenesis and gluconeogenesis. CBP is also implicated in the etiologies of several other diseases including hematologic malignancies and other solid tumors, diabetes, schizophrenia, Alzheimer's disease, depression, and many other neurological conditions.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 57609366624

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.1 ★★★★★
Based on 9 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
J
Verified Purchase
Jordan P
Bozeman, US
★★★★★ 5
Great little sprayer
Size: 1-Gallon
This thing works really well. My only complaint is that you can't really get a tight cone on the mist setting. I wanted to be a little more precise, but it still got the job done. I would recommend this more for lawn treatments over bug spray (which is what I used it for), just because of the wide dispersal cone (especially indoors). However, it still works just fine, and gives a lot of coverage in a short amount of time. It does shoot a very precise stream out, but it's way too much liquid at once in my opinion. If you're wanting precision, you'll need to look elsewhere. As for the value, it's well worth it.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 25, 2026
D
Verified Purchase
DAVE D
Houston, US
★★★★★ 5
Chapin 1-gallon sprayer
Size: 1-Gallon, Size: 1-Gallon
★★★★★ Versatile Little Sprayer That’s Great Around the House, Garden & Garage. This Chapin 1-gallon sprayer has turned out to be one of the handiest tools I own. I originally bought it for spraying organic bug treatment and neem oil mixtures on my plants and garden, but I’ve ended up using it for several different things. The pump builds pressure quickly and the spray pattern adjusts easily from a fine mist to a stronger stream depending on what you’re doing. It sprays evenly and feels much more controlled than some of the cheaper sprayers I’ve tried in the past. One thing I like is keeping separate sprayers for different jobs. I use this one mainly for garden and plant care, while I keep another one strictly for bug spray and outdoor treatments so chemicals don’t get mixed together. It’s also useful outside the garden. You could easily use this for automotive detailing too — things like liquid waxes, degreasers, wheel cleaners, or spray-on protectants. The wand and hose feel durable, and the tank itself feels sturdy without being too heavy to carry around. Simple, reliable, easy to clean, and useful for way more than just gardening. Definitely worth having around the house or garage.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 16, 2026
N
Verified Purchase
NJ2NC ALSO
Los Angeles, US
★★★★★ 4
Works well. Easy to carry.
Size: 1-Gallon 2-Value Pack
My 2-gallon sprayer’s nozzle cracked — leading to Spectracide dribbles along my path through the yard…not good! Since a replacement nozzle cost as much as a new sprayer, so began the search for a new unit. I admit that lugging a full 2-gal sprayer around the yard, although it required no refilling, became quite tiring and blister-inducing; I then began reading reviews for 1-gal … Horror stories about bad seals, leaks, no pressure, etc. had me dismayed. However, since Amazon’s return policy is easy, I decided on this 2-pack of 1-gal Chapin 22000. If needing my usual 1.5-2 gallons of weed killer, I could always fill BOTH ahead of time and save myself some blisters and backache! Never having used pressurized sprayers WITHOUT pressure relief valves, I was slightly hesitant to buy these, though…well, I guess I’ll just have to be extremely careful to not get the poisonous spray on myself when removing the pump! ☠️ Sprayers arrived in perfect, brand new condition; all parts/pieces were received. Assembly was super easy, even WITHOUT referring to instruction manual — used channel locks to tighten the hose, as pliers could not be located and hands are not very strong. Tested/practiced with water. Got a feel for how many pumps were necessary and adjusted the spray tip to my preference. My last sprayer required opening the PRV and then squeezing sprayer to empty hose/release remaining pressure in order to be able to unscrew pump handle. The directions for THESE say to simply unscrew the handle a bit until you can hear the built-up pressure vent out. I did just that — no explosive spray to the face and the pump handle unscrewed easily. WHEW! So, today was the sprayer’s maiden voyage around the yard. I followed the directions to pump the handle until resistance is felt (maybe 8x?). WOW — so much easier to carry! Pressure is great — liquid shot out about 15’! Although the “feel” of the sprayer trigger is cheap and small (even for female hands), it was quite responsive and allowed for a steady stream with no leaks/dribbles. Happy with this purchase and hope I can get at least a few years out of them. 🤞🏼 Also, after I’d placed my order, I just happened to be in WM’s lawn/garden section… These are sold there, as well, for a higher price. They seem to be very popular, too, as nearly all were gone from the shelf.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 1, 2026
A
Verified Purchase
Atom
Houston, US
★★★★★ 5
Simple, Reliable Pump Sprayer with Easy Locking Trigger
Size: 1-Gallon
This pump sprayer is very straightforward to set up and gets ready for use quickly without any complicated assembly. The locking trigger is a standout feature since it allows continuous spraying without needing to constantly hold the handle down, which makes longer watering or treatment tasks much easier on the hand. The spray output feels consistent and controlled, and it works well for garden applications like fertilizer, herbicide, or general watering. The build quality feels solid enough for regular home and garden use, and the tank is easy to fill and pressurize without much effort. The handle and pump action feel smooth, and overall operation is simple and intuitive. Considering the ease of use, practical locking trigger, quick setup, and reliable performance, it offers good value for the money for everyday garden and yard maintenance tasks.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 14, 2026
R
Verified Purchase
RDS
Belleville, US
★★★★★ 5
Solid product at affordable price
Size: 1-Gallon
It’s working well so far after a couple spraying with it; easy to assemble; good delivery, good price. It’s a good one to get for spraying foliage in your yard.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 14, 2026

recommand products