SKU: 57783255321

Human CD34, hFc tag

Sale price$180.00 Regular price$200.00
Save 10%

Pay in installments of $50.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 28 - Sep 2

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human CD34, hFc tagProduct Specification Species Human Accession P28906 Amino Acid Sequence Protein sequence(P28906, Ser32 Thr290, with C hFc)

Product Specification


Species Human
Accession P28906
Amino Acid Sequence

Protein sequence(P28906, Ser32-Thr290, with C-hFc) SLDNNGTATPELPTQGTFSNVSTNVSYQETTTPSTLGSTSLHPVSQHGNEATTNITETTVKFTSTSVITSVYGNTNSSVQSQTSVISTVFTTPANVSTPETTLKPSLSPGNVSDLSTTSTSLATSPTKPYTSSSPILSDIKAEIKCSGIREVKLTQGICLEQNKTSSCAEFKKDRGEGLARVLCGEEQADADAGAQVCSLLLAQSEVRPQCLLLVLANRTEISSKLQLMKKHQSDLKKLGILDFTEQDVASHQSYSQKTEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

Expression System HEK293
Molecular Weight Theoretical:53.5 kDa Actual:115 kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/mg
Tag with C-hFc
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

CD34 is a transmembrane phosphoglycoprotein protein encoded by the CD34 gene in humans, mice, rats and other species. CD34 derives its name from the cluster of differentiation protocol that identifies cell surface antigens. CD34 was first described on hematopoietic stem cells independently by Civin et al. and Tindle et al. as a cell surface glycoprotein and functions as a cell-cell adhesion factor. It may also mediate the attachment of hematopoietic stem cells to bone marrow extracellular matrix or directly to stromal cells. Clinically, it is associated with the selection and enrichment of hematopoietic stem cells for bone marrow transplants.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 57783255321

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.6 ★★★★★
Based on 23 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
M
Verified Purchase
Meghan
Louisville, US
★★★★★ 5
Very effective!
Size: 4 Ounce (Pack of 1), Set name: A. Strawberry Mango
I switched my son to this toothpaste and it has been great! I haven’t noticed whitening, but his teeth do look good and clean after he has brushed. He loves the flavor. And he is one to complain about “spicy” toothpaste. This toothpaste has never been whined about in my household. In fact, switching to this toothpaste has made brushing his teeth simpler because he enjoys the flavor so much. I have noticed it doesn’t foam up like other toothpaste’s do. Another side story, and probably the biggest thing, I think this is actually shrinking my sons cavities. His pediatric dentist told me he would need fillings before his teeth could fall out at 12 (12 year molars). I saw the cavities on the xrays. A year later, the cavities are smaller. And the dentist said if things can maintain this way, there will be no need for fillings! He does brush morning and night, and often after lunch because we homeschool and he has that ability. But I’m just thrilled that my son could potentially avoid this procedure!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 23, 2026
K
Verified Purchase
Kiona K
Omaha, US
★★★★★ 5
Love this stuff! Both toddler and mom approved
Size: 4 Ounce (Pack of 1), Set name: A. Strawberry Mango
I'm a repeat buyer! My toddler loves the taste and I love the ingredients. Boka is an awesome brand and I feel safe giving it to my kids and knowing their teeth are being cleaned.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 18, 2026
K
Verified Purchase
Kari
West Palm Beach, US
★★★★★ 5
Love
Size: 4 Ounce (Pack of 2), Set name: G. Orange Cream, Ela Mint
Great toothpaste, kids loves the orange, very subtle taste not too strong. The mint is great tasting and mild. Teeth feel very clean. And best of all NO TOXIC FLUORIDE!!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 3, 2026
S
Verified Purchase
Seeker
Dallas, US
★★★★★ 5
More than a book-the Universe is nudging you to go here!
Format: Paperback
Where do I begin, where am I now, where am I going and how do I get there. I've been a Kundilini student for years. Masuda has been my teacher, guide and friend. No matter where I find myself at any given time or place, and whether I'm looking for understanding universal truths, tools, practices, or insights, this book points me. You have to do the work, but you want to because with this book you'll understand why and know how. On any given day, you will find a roadmap visually, spiritually and practically to empower your Chakras. So what are they... why do Chakras matter..how do I understand and develop their power in me. Masuda does an extraordinary job explaining, illustrating and giving you all the practice tools in a way that works for you. Personally, I love this book because I can take it with me anywhere, can choose/find what I need from it at any given time and she explains and shows me what to do and how to get there. It's so easy to follow and the results are so meaningful. I'm a visual person... In the most perfect ways this book leads me, and shows me physically and mentally. I can back up or move faster depending on where the universe points me and then I do the work. Bottom line, I'm a better human. Thank you Masuda for this extraordinary 'lesson planner' and helping me unlock what's already in me!!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 2, 2024
A
Verified Purchase
Amazon Customer
Chelsea, US
★★★★★ 5
The empowerment tool we all needed!!
Format: Paperback
Wow, okay where do I start?? Before I opened the book, I had a general sense of yoga and chakras. Being a Reiki practitioner, but a fairly new one, I’ve learned how critical balancing chakras is to feeling healthy and pain-free, but I never took enough time to work on my own. This book makes it so easy to understand what can be sometimes complex ideas for people new to the space of wellness and yoga. There’s truly never a dull moment and I love the option to read page by page or flip to the section you need. It’s extremely well written and I loved the intro from Masuda. She shared her personal story which was so relatable and further inspired me to start my journey of a balanced chakra system that I know will only aid me further in my life’s purpose. It’s also pretty cool to know I’ll have a tool in the form of this book to reference anytime I might be experiencing symptoms of a chakra that needs my attention. It’s literally a life/soul manual, who doesn’t need that? So grateful Masuda chose to share her tools and practice with so many all over the world. This is the ultimate gift for anyone in your life! I can’t wait to tell more people about it.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 9, 2023

recommand products