SKU: 58514775060

Human CKM, His tag

Sale price$101.25 Regular price$112.50
Save 10%

Pay in installments of $28.12 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 29 - Sep 3

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human CKM, His tagProduct Specification Species Human Synonyms Creatine kinase M chain, Creatine phosphokinase M type (CPK M), M CK, CKMM Accession P06732 Amino Acid Sequence Protein sequence (P06732, Met1 Lys381, with C 10*His)

Product Specification


Species Human
Synonyms Creatine kinase M chain, Creatine phosphokinase M-type (CPK-M), M-CK, CKMM
Accession P06732
Amino Acid Sequence

Protein sequence (P06732, Met1-Lys381, with C-10*His) MPFGNTHNKFKLNYKPEEEYPDLSKHNNHMAKVLTLELYKKLRDKETPSGFTVDDVIQTGVDNPGHPFIMTVGCVAGDEESYEVFKELFDPIISDRHGGYKPTDKHKTDLNHENLKGGDDLDPNYVLSSRVRTGRSIKGYTLPPHCSRGERRAVEKLSVEALNSLTGEFKGKYYPLKSMTEKEQQQLIDDHFLFDKPVSPLLLASGMARDWPDARGIWHNDNKSFLVWVNEEDHLRVISMEKGGNMKEVFRRFCVGLQKIEEIFKKAGHPFMWNQHLGYVLTCPSNLGTGLRGGVHVKLAHLSKHPKFEEILTRLRLQKRGTGGVDTAAVGSVFDVSNADRLGSSEVEQVQLVVDGVKLMVEMEKKLEKGQSIDDMIPAQKGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Predicted MW: 44.8 kDa Observed MW: 45, 50 kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Tag with C-10*His
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

Creatine kinase, muscle also known as MCK is a creatine kinase. The protein is a cytoplasmic enzyme involved in cellular energy homeostasis. The protein reversibly catalyzes the transfer of "energy-rich" phosphate between ATP and creatine and between phospho-creatine and ADP. Its functional entity is a MM-CK homodimer in striated (sarcomeric) skeletal and cardiac muscle. In heart, in addition to the MM-CK homodimer, also the heterodimer MB-CK consisting of one muscle (M-CK) and one brain-type (B-CK) subunit is expressed. The latter may be an important serum marker for myocardial infarction, if released from damaged myocardial cells into the blood where it can be detected by clinical chemistry.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 58514775060

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.0 ★★★★★
Based on 7 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
S
Verified Purchase
shadow
Houston, US
★★★★★ 4
Works Great but the price is rising!
Anua Azelaic Acid is a very good serum. Both my daughter and I use it regularly. My daughter has severe rosacea, and this has helped calm her skin significantly her redness is almost gone. For me, it has also made a noticeable difference by reducing redness and giving my skin a healthy glow. We both use it at night, and it’s definitely very soothing and calming. The formula is gentle, lightweight, and works really well for sensitive skin without causing irritation. However, the only downside is the price, it seems to have increased quite a bit recently, which is concerning. I bought a couple during Amazon Prime Day, which worked out really well. For a relatively simple azelaic acid serum, the price increase feels a bit steep. If the price continues to rise, I may need to look for a more budget-friendly alternative. Otherwise, it’s a really great serum that delivers great results.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 30, 2026
E
Verified Purchase
Ella Carpenter
Lowell, US
★★★★★ 5
DERM APPROVED!
I am obsessed with this product!! This feels very luxurious on my skin and does not pill like other products I have had in the past. I have noticed a significant improvement in the background redness in my skin. As someone who works in derm and values good ingredients and products that actually work... I can confidently say that this is the best OTC azelaic acid product I have tried out. It sits very nicely under my moisturizer and does not dehydrate my skin like other azelaic acid products have done in the past. HIGHLY RECOMMEND
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 10, 2026
P
Verified Purchase
Paisley Stewart
Chelsea, US
★★★★★ 5
A Game Changer for Sensitive Skin
I use this serum every single day, and it has become one of the most important products in my skincare routine. I have very sensitive skin and cannot tolerate stronger active ingredients such as retinol or high-strength acids, so finding something effective but gentle has been incredibly important. This serum has helped calm redness, reduce inflammation, and noticeably improve my skin’s overall appearance and comfort. After dealing with a prolonged inflammatory skin condition, this product made a significant difference and helped restore my skin barrier. The formula feels soothing, hydrating, and non-irritating. If you have sensitive or reactive skin and are looking for a gentle product to help with redness and uneven texture, I highly recommend giving this serum a try. Photos attached: The green bottle is the product and the second photo includes my favorite additions.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 13, 2026
B
Verified Purchase
Bri M.
Dallas, US
★★★★★ 5
Perfect for Acne-Prone Skin!
This serum has honestly been a great addition to my routine for redness and post-acne marks. The texture is lightweight, hydrating, and doesn’t feel sticky or heavy on my oily/acne-prone skin. I have sensitive skin with a focus on barrier protection, and this didn’t irritate my skin at all. It layers beautifully with the rest of my skincare and leaves my skin looking calmer and smoother over time. AND, it doesn’t have a smell!! Definitely one of my favorite azelaic acid serums I’ve tried.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 18, 2026
S
Verified Purchase
SDS
Chelsea, US
★★★★★ 5
Great product with unexpected results and skincare benefits
Size: 25 Count (Pack of 1)
I have been reading about Micellar water products for a couple of years, and finally purchased these wipes to try. I am currently working very long hours and the selling point for these wipes was that they weren't soap-based, and didn't require a toner after using. I keep them on my night stand and take my makeup off with them prior to going to bed. (I do not use them for removing mascara - I use another product for that.) The biggest point I want to share is that I have been using these wipes exclusively for makeup removal for a little more than two weeks. I have had a stubborn blackhead on my nose for a good 20 years that wouldn't budge, no matter how often I used exfoliating products, and I've invested a lot of money in high end exfoliators in an attempt to make that spot go away. It has grown larger over the years, and was a skincare peeve of mine. I noticed a couple of days ago that that blackhead is beginning to break down and get smaller. I thought at first that I was imagining it, but that blackhead is honestly a good two-thirds gone. This is just from using these wipes! I would never have predicted that something this simple and quite soft and insubstantial as a disposable face wipe would have such effective results for blackhead breakdown, but they're doing the trick. I have noticed smaller blackheads on my chin area are also melting away. I predict that in another few weeks of use, my skin is going to be as close to blackhead-free as it is humanly possible to achieve. (For the record, I don't have a lot of blackheads - just a handful that have taken up residence over the years and refused to budge, getting larger with age.) These are safe for my sensitive skin, and have exfoliating benefits that I wouldn't ever have expected or predicted. Full disclosure: I do spend a good 3-5 minutes using a single wipe on my face, neck, and décolletage, scrubbing with the nubby side (there is a nubby, exfoliating side, and smooth side to each wipe) and using the whole cloth in sections until I have used it all. Finally, I also use it on the tops of my hands. I definitely get my money's worth out of each wipe! I wholeheartedly encourage people to try this product. I now have it on Auto-Ship status, as I don't want to ever be without these wipes in my skincare arsenal.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 23, 2016

recommand products