SKU: 59343087061

CD63 His Tag Protein, Human

Sale price$271.80 Regular price$302.00
Save 10%

Pay in installments of $75.50 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 30 - Sep 4

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

CD63 His Tag Protein, HumanProduct Specification Species Human Antigen CD63 Synonyms LAMP 3, MLA1, TSPAN30 Accession P08962 Amino Acid Sequence Ala103 Val203, with C terminal 8*His AGYVFRDKVMSEFNNNFRQQMENYPKNNHTASILDRMQADFKCCGAANYTDWEKIPSMSKNRVPDSCCINVTVGCGINFNEKAIHKEGCVEKIGGWLRKNVGGGS Expression System HEK293 Molecular Weight 20 31kDa Purity 95% by SDS PAGE Endotoxin <0. 1EU g Conjugation Unconjugated Tag His Tag Physical Appearance Lyophilized Powder Storage Buffer PBS, pH7.

Product Specification


Species Human
Antigen CD63
Synonyms LAMP-3, MLA1, TSPAN30
Accession P08962
Amino Acid Sequence

Ala103-Val203, with C-terminal 8*His AGYVFRDKVMSEFNNNFRQQMENYPKNNHTASILDRMQADFKCCGAANYTDWEKIPSMSKNRVPDSCCINVTVGCGINFNEKAIHKEGCVEKIGGWLRKNVGGGS

Expression System HEK293
Molecular Weight

20-31kDa

Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution

Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.

Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1. Sònia Tugues. Tetraspanin CD63 Promotes Vascular Endothelial Growth Factor Receptor 2-β1 Integrin Complex Formation, Thereby Regulating Activation and Downstream Signaling in Endothelial Cells in Vitro and in Vivo. 2. J Biol Chem 2013 Jun28;288(26):19060-71. Epub 2013 Apr 30.

Background

CD63 is a member of the transmembrane-4 glycoprotein superfamily, known as tetraspanins. The tetraspanins contain four transmembrane domains, two extracellular loops flanked by short intracellular N and C termini, and a highly conserved sequence motif within the larger extracellular domain. Tetraspanins interact among themselves and with other transmembrane proteins to form membrane domains denoted tetraspanin-enriched microdomains (TEMs). At least in part through the TEMs, tetraspanins regulate a variety of cellular processes including cell fusion, intracellular trafficking, cell adhesion, motility, invasion, and cell differentiation. CD63 is among the most highly expressed tetraspanins in endothelial cells (ECs). Still, the role of CD63 in endothelial biology and angiogenesis remains to be addressed. We show that CD63 is co-localized with the type I integral lysosomal membrane protein (LAMP-1) but also present on the EC surface. By silencing CD63 expression in primary ECs, we demonstrate that CD63 associated with both β1 integrin and VEGFR2 in the plasma membrane and was required for VEGFR2-β1 integrin complex formation. Loss of CD63 expression disrupted downstream signaling path ways both in endothelial cells in culture and in intact tissues. As a consequence, CD63-deficient ECs failed to engage in sprouting angiogenesis and organize into tube structures.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 59343087061

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.1 ★★★★★
Based on 24 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
K
Verified Purchase
KA
Pawtucket, US
★★★★★ 5
Blue ball, my dog likes blue.
Just a ball right? Evidently not! My dog won’t chase an orange chuck it ball or the glow in the dark ball- only the blue one 🤷🏼‍♀️
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 9, 2025
B
Verified Purchase
Baker-s
Draper, US
★★★★★ 3
I wanted a blue ball
It's great. It just wasn't blue.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 5, 2026
J
Verified Purchase
Jr
New York, US
★★★★★ 5
its a great ball
works well
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on July 8, 2025
L
Verified Purchase
Lorraine Nathanson
Dallas, US
★★★★★ 5
Colorful, Sturdy & Great Value
Color: Large Set of 4
Purchased for our two puppies when they were 2 months old and weighed about 14 pounds so theses balls were a little big for them to hold in their mouths but that didn't stop them from trying. While they did like these balls they much preferred softer soccer balls, the later of which did not hold up well at all. I had hoped they would play with these balls more when they were older but that hasn't happened 5 months later. I guess it's no fun if you can't tear the toy apart. Colors are very bright and they do enjoy chasing after them as long as I am the one rolling them across the room for them. Maybe when they progress to batting things with their paws they will start to do this for themselves.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 18, 2025
E
Verified Purchase
Erik
Houston, US
★★★★★ 5
My pup loves them
Color: Large Set of 4
Colors are bright and my dog loves the squeaky! Good size no worries of choking.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on September 10, 2025

recommand products