SKU: 59794751311

GIPR His Tag Protein, Human

Sale price$342.00 Regular price$380.00
Save 10%

Pay in installments of $95.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 27 - Sep 1

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

GIPR His Tag Protein, HumanProduct Specification Species Human Accession P48546 1 Amino Acid Sequence Arg22 Gln138, with C terminal 8*His RAETGSKGQTAGELYQRWERYRRECQETLAAAEPPSGLACNGSFDMYVCWDYAAPNATARASCPWYLPWHHHVAAGFVLRQCGSDGQWGLWRDHTQCENPEKNEAFLDQRLILERLQGGGSHHHHHHHH Expression System HEK293 Molecular Weight 25 34 kDa(Reducing) Purity 95% by SDS PAGE Endotoxin <0. 1EU g Conjugation Unconjugated Tag His Tag Physical Appearance Lyophilized Powder Storage Buffer PBS, pH7. 4

Product Specification


Species Human
Accession P48546-1
Amino Acid Sequence Arg22-Gln138, with C-terminal 8*His RAETGSKGQTAGELYQRWERYRRECQETLAAAEPPSGLACNGSFDMYVCWDYAAPNATARASCPWYLPWHHHVAAGFVLRQCGSDGQWGLWRDHTQCENPEKNEAFLDQRLILERLQGGGSHHHHHHHH
Expression System HEK293
Molecular Weight 25-34 kDa(Reducing)
Purity

>95% by SDS-PAGE

Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.

Background

Glucose-dependent insulinotropic polypeptide receptor (GIPR) are G protein-coupled receptors belonging to the secretin receptor super-family, also known as class B1. GIPR comprises an N-terminal extracellular domain (ECD), a central domain consisting of seven transmembrane α-helices, and a C-terminal, cytoplasmic domain that mediates intracellular signal transduction by physical association with the G protein. GIPR increases insulin secretion in hyperglycemia and stimulates glucagon release in hypoglycemia. It also plays an important role in adipogenesis, islet β cell proliferation and insulin release, and is associated with type 2 diabetes, obesity and neurodegenerative diseases.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 59794751311

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.8 ★★★★★
Based on 5 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
D
Verified Purchase
Diana Dunlap
Alexandria, US
★★★★★ 5
Great product. Love that the water drains into the sink. Not all over my sink back.
Color: Black, Size: 7.9" x 3.7" x 6.2", Color: Black, Size: 7.9" x 3.7" x 6.2"
Very sturdy, functional and decorative.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 11, 2026
M
Verified Purchase
MH18
Port Orchard, US
★★★★★ 4
Pretty good size, and storage but it moves a little.
Color: Black, Size: 7.9" x 3.7" x 6.2"
I ordered this in black, and it holds a large bottle of hand soap, my dish wand, and two other sponges/scrubbers. It really does drain into the sink, but you have to be careful to place it on the edge of the sink, or the water will drip onto the counter. Also, it's very light, so if you only have a few items in it, it's likely to move or fall when you reach for a sponge. Since we put a solid bottle of hand soap in there, it is much more stable, even when I'm using the pump dispenser. I can't tell if it's rustproof for long-term use, but so far it's functional after adding something to weigh it down. I like it much better than the flat sponge caddy we had before, and the quality seems good. I would like it to be more stable, but otherwise it's useful
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 18, 2026
R
Verified Purchase
Regina
Los Angeles, US
★★★★★ 5
Beautiful Organizer
Color: Gold, Size: 7.9" x 3.7" x 6.2"
Perfect for my sponges and bottle cleaners. Keeps my kitchen organized
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 15, 2026
A
Verified Purchase
Alma
Lowell, US
★★★★★ 5
Compact, Versatile, and No Rust So Far
Color: Black, Size: 7.9" x 3.7" x 6.2", Color: Black, Size: 7.9" x 3.7" x 6.2"
I looked around quite a bit before buying this because a lot of sellers offer the same or very similar design. I even saw versions with a dedicated spot for a Scrub Daddy, but I didn’t feel like paying extra for that. I went with this one hoping it would still work for my setup, and it absolutely does. I’m limited on counter space, and this doesn’t take up much room at all. The removable brush holder cup is a big plus, I removed it and use that space for my Sponge Daddy, which fits perfectly. It also fits my hand soap and dish soap bottles without any issues, and I use the brush holder section to hold clean utensils. I’ve been using this for almost two months now and wash dishes constantly, so there’s pretty much always some water dripping from the sponge while it dries. So far, there’s been no rusting and no color chipping, which was something I was concerned about. Overall, it works perfectly for my needs and feels well made.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 24, 2026
C
Verified Purchase
Cal
Lowell, US
★★★★★ 3
Design Is Great. Material Was A Very Poor Choice.
Color: Black, Size: 7.9" x 3.7" x 6.2"
The gauge of the wire used is pretty thin. There is no real weight to this item. It does do exactly what I need it to do as it allows me to dry my dish cleaning brushes and my Dawn Puff brush in an organized manner. The taller basket is nice especially for my long handled brushes. It would actually be nice if there was a second basket since I have more handled brushes than anything else. I am also really happy that I went with this design where the drain pan is the entire length rather than a little spout where all the drainage is focused. The full length lines up better to usage of each individual brush. Due to its materials, I don't have much confidence in this being around long. So far, the black coating has held up and no r*sting (do not want to jinx myself) has occurred, but if and when it does, I fully expect the metal to fold like a house of cards. The design is actually great. The materials are its Achielles' Heel.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 11, 2026

recommand products