SKU: 60042591362

RENIN (R66K) His Tag Protein, Human

Sale price$362.70 Regular price$403.00
Save 10%

Pay in installments of $100.75 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 27 - Sep 1

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

RENIN (R66K) His Tag Protein, HumanProduct Specification Species Human Antigen Renin Synonyms REN, FLJ10761, Renin, angiotensinogenase Accession P00797 Amino Acid Sequence Leu24 Arg406 (R66K), with C terminal 8*His

Product Specification


Species Human
Antigen Renin
Synonyms REN, FLJ10761, Renin, angiotensinogenase
Accession P00797
Amino Acid Sequence

Leu24-Arg406 (R66K), with C-terminal 8*His LPTDTTTFKRIFLKRMPSIRESLKERGVDMARLGPEWSQPMKKLTLGNTTSSVILTNYMDTQYYGEIGIGTPPQTFKVVFDTGSSNVWVPSSKCSRLYTACVYHKLFDASDSSSYKHNGTELTLRYSTGTVSGFLSQDIITVGGITVTQMFGEVTEMPALPFMLAEFDGVVGMGFIEQAIGRVTPIFDNIISQGVLKEDVFSFYYNRDSENSQSLGGQIVLGGSDPQHYEGNFHYINLIKTGVWQIQMKGVSVGSSTLLCEDGCLALVDTGASYISGSTSSIEKLMEALGAKKRLFDYVVKCNEGPTLPDISFHLGGKEYTLTSADYVFQESYSSKKLCTLAIHAMDIPPPTGPTWALGATFIRKFYTEFDRRNNRIGFALARGGGSHHHHHHHH

Expression System HEK293
Molecular Weight 45-50kDa
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1. Yokosawa, H. et al. (1980) J. Biol. Chem. 255:3498. 2. Fuminaki, S. et al. (2004) in Handbook of Proteolytic Enzymes, Barret, A. J. et al. eds. p. 54.

Background

Human Renin is a member of the aspartyl proteinase family produced largely in part by the juxtaglomerular cells in the kidney. Renin is also known as REN and angiotensinogenase, is a circulating enzyme that participates in the body's renin-angiotensin system (RAS), and plays an essential role in the elevation of arterial blood pressure and increased sodium retention by the kidney. Renin activates the renin-angiotensin system by cleaving angiotensinogen, produced by the liver, to yield angiotensin I, which is further converted into angiotensin II by ACE, the angiotensin-converting enzyme primarily within the capillaries of the lungs. Renin is secreted from kidney cells, which are activated via signaling from the macula densa, which responds to the rate of fluid flow through the distal tubule, by decreases in renal perfusion pressure (through stretch receptors in the vascular wall), and by sympathetic nervous stimulation, mainly through beta-1 receptor activation. Renin can bind to ATP6AP2, which results in a fourfold increase in the conversion of angiotensinogen to angiotensin I over that shown by soluble renin. In addition, renin binding results in phosphorylation of serine and tyrosine residues of ATP6AP2. The level of renin mRNA appears to be modulated by the binding of HADHB, HuR and CP1 to a regulatory region in the 3' UTR. An over-active renin-angiotension system leads to vasoconstriction and retention of sodium and water. These effects lead to hypertension. Therefore, renin inhibitors can be used for the treatment of hypertension. Renin differs from the other members of this class by having a pH optimum near the neutral pH region with native substrates instead of a pH 2.0 to 3.4 range.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 60042591362

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.7 ★★★★★
Based on 25 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
D
Verified Purchase
DPLK
Massapequa, US
★★★★★ 5
Soft AND supportive
Number of Items: 1
I knew I needed a very soft pillow - all the foam pillows I had bought recently to try to upgrade our home pilllow selection seemed ok to the touch but were still too firm once I tried them out, but recently I also had some neck pain that needed some gentle support and the old old foam pillow I had that was so very soft was losing its supportive qualities and the pain wasn’t getting better. This one seemed by description to fit the bill- very soft by the company’s own definition but also with support. I’m happy to report this is exactly as advertised- the softest foam pillow I’ve tried out of the box but also good support. Pain has improved since I started using this pillow. I would buy more if we need more pillows, it’s perfect for me and I think would be comfortable for most people. I think you just need to figure out how firm you need your pillow and also height preference . I’m an all over sleeper -back, side, even belly sometimes, so it’s fine for me, but it is a little taller compared to other pillows I’ve bought recently. I didn’t compare/try other prominent pillow brands, mostly my experience is Ikea (my daughter uses a very flat and nice foam pillow from them that is even a little pricier than this one and it works well for her), and whatever brands happen to be available at target and Costco. This price point for a name brand is reasonable, I think; I was looking at other brands way over $100, and I was willing to spend that much for something that would work long term, so this one working was great. Also, this definitely does not have any cooling effect technology, which is fine by me, but something to consider if you do like cool pillows. (Although, PSA: I recently had to throw away older foam pillows that had those cooling gel panels because the gel panels started disintegrating into sticky ooze; gross and had to throw away whole pillow because couldn’t dissociate from rest of the pillow. Sad cuz the foam part of those pillows were fine.) Anyway, if you like softer pillows but want good support, this one works well and is worth trying!!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 30, 2025
L
Verified Purchase
Lori Wornom
West Palm Beach, US
★★★★★ 4
Flatter than a regular pillow but nice and soft
Number of Items: 1
Is it softer than a typical memory foam pillow? Yes. But it’s also a lot flatter. I don’t find this pillow rebounds very well. It’s good for stomach sleepers but not so much for side sleepers. I’m a 2/3 of the night side sleeper so it’s unfortunately not my magic pillow.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 11, 2026
M
Verified Purchase
Matt
Cuba, US
★★★★★ 5
Best pillow for my neck pain.
Number of Items: 1
I've tried so so many pillows to relieve my neck pain at night and this one is the first pillow that has actually worked. I was skeptical at first as this pillow is heavy and dense but one night and I was hooked. I couldn't believe I found a pillow that actually not only was comfortable but also relieved my neck strain. It's worth the cost to now be able to wake up without pain.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 8, 2026
S
Verified Purchase
Sus from South Africa
Phoenix, US
★★★★★ 5
Tempur-Cloud Pillow
Number of Items: 1
My daughter has been struggling to find a good pillow that does not hurt her ears. She is a tummy sleeper, as am I. I have also been struggling to find the perfect pillow. I heard about Tempur pillows and thought it a good idea to buy my daughter a pillow for her birthday. It arrived last night. She tried it out during the night. When she woke up this morning, the first thing she said was that the pillow is amazing. It was a good night for her. She said it felt like sleeping on a marshmallow - soft enough to not hurt her ears but firm enough to support her neck. The pillow is very comfortable. 😊
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 29, 2026
A
Verified Purchase
Agnieszka J.
New York, US
★★★★★ 3
Just ok
Number of Items: 1
This pillow flattens so much I’m not sure if it’s a legit tempur pedic or not. I bought one previously from Tempur Pedic store and the quality is better plus is more supportive. This one is meh . I gave it to my husband, he doesn’t care
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 13, 2026

recommand products