SKU: 61468011580

CLEC-1 Fc Chimera Protein, Human

Sale price$345.60 Regular price$384.00
Save 10%

Pay in installments of $96.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 30 - Sep 4

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

CLEC-1 Fc Chimera Protein, HumanProduct Specification Species Human Synonyms C type lectin domain family 1 member A, C type lectin like receptor 1 Accession Q8NC01 Amino Acid Sequence Gln74 Asp280, with N terminal Human IgG Fc

Product Specification


Species Human
Synonyms C-type lectin domain family 1 member A, C-type lectin-like receptor 1
Accession Q8NC01
Amino Acid Sequence

Gln74-Asp280, with N-terminal Human IgG Fc PKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKIEGRQYYQLSNTGQDTISQMEERLGNTSQELQSLQVQNIKLAGSLQHVAEKLCRELYNKAGAHRCSPCTEQWKWHGDNCYQFYKDSKSWEDCKYFCLSENSTMLKINKQEDLEFAASQSYSEFFYSYWTGLLRPDSGKAWLWMDGTPFTSELFHIIIDVTSPRSRDCVAILNGMIFSKDCKELKRCVCERRAGMVKPESLHVPPETLGEGD

Expression System HEK293
Molecular Weight 55-65kDa
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag Human Fc
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1.Sci Adv . 2022 Nov 16;8(46):eabo7621. Epub 2022 Nov 18.

Background

CLEC-1 (C-type lectin-like receptor-1) is a type 2 transmembrane protein that belongs to the Dectin-1 family of C-type lectins. CLEC-1 is most highly expressed in activated dendritic cells and at lower levels in endothelial cells and monocytes. Dendritic cells (DCs) represent essential antigen-presenting cells that are critical for linking innate and adaptive immunity, and influencing T-cell responses. Studies have shown that CLEC-1 acts as an inhibitory receptor in dc, which can inhibit activation and downstream effect Th response. As a cell surface receptor, CLEC-1 may be a useful therapeutic target in the clinical regulation of t cell immune responses.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 61468011580

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.6 ★★★★★
Based on 6 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
A
Verified Purchase
Ang
Carnegie, US
★★★★★ 5
Long lasting charge!
Color: Orange
My 50 pound goldendoodle absolutely loves this ball. It keeps a charge for a long time. It turns off When it’s not being used and we play with it every day.!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 24, 2026
E
Verified Purchase
Emeraldcity
Birmingham, US
★★★★★ 5
Fun toy
Color: Orange
My standard poodle loves this toy. It holds a charge for several hours and is well made
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 8, 2026
K
Verified Purchase
Kindle Customer
San Leandro, US
★★★★★ 5
Amazing Buy
These masks are exactly what they say on the package. 10/10 Clears, smooths, and moisturizes your face. Keep on over night, easy to use
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 8, 2026
A
Verified Purchase
Aly
New York, US
★★★★★ 5
Favorite for dry climate
I live in a dry desert and these are the only moisturizing masks I see instant results. For best results after doing my evening skincare routine I apply the mask one hour before bed. I store them in the fridge so they feel cool and soft on my skin. Once you get the hang of applying them it’s very easy the second time. I sleep with them on and remove them in the morning and my skin is glowing, plump and pores appear smaller. The mask itself is a thick durable jelly not like the typical sheet masks. The price for this is worth it if you wear the mask minimum 2-5 hours once a week
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on November 12, 2025
A
Verified Purchase
Ann D
Battle Creek, US
★★★★★ 5
Youth Serum?
You will not regret trying this! The results are amazing!!! 🤩 After the first use my skin looked healthier, brighter, more even toned and pores were diminished. I look young again. (I’m 57.) I have neglected my face for a few years after being the kind of girl who never left the house without makeup. I knew I needed some deep repair and thought a mask would help. Lo and behold, my beloved Amazon gave me Biodance! I just used my third mask last night and I’m still excited to peel it off the next morning. My face doesn’t look all dewy like the pictures and video but it’s definitely a huge improvement. I didn’t realize it was that dry. A couple tips-don’t worry when you first apply it if it’s not perfectly positioned. There is wiggle room and it will slide a bit. Handle carefully! It’s slimy & slippery. You can use the eyes and lips (cut outs) for other problem areas and you can tear off the nose as well. It feels cooling the moment you put it on. I had no irritation at all. I took the advice of one reviewer and sat on the couch with my head leaned back for about an hour before I went to bed to let it dry a little. Nice “ME” time. Thanks a zillion Amazon and Biodance! I vow to use a mask weekly from now until the end of time. ❤️
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 14, 2025

recommand products