SKU: 62426405680

Cystatin-C His Tag Protein, Human

Sale price$135.00 Regular price$150.00
Save 10%

Pay in installments of $37.50 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 29 - Sep 3

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Cystatin-C His Tag Protein, HumanProduct Specification Species Human Synonyms Cystatin CCystatin CCystatin 3CST3 Accession P01034 Amino Acid Sequence Ser27 Ala146, with N 6*His MHHHHHHDDDDKSSPGKPPRLVGGPMDASVEEEGVRRALDFAVGEYNKASNDMYHSRALQVVRARKQIVAGVNYFLDVELGRTTCTKTQPNLDNCPFHDQPHLKRKAFCSFQIYAVPWQGTMTLSKSTCQDA Expression System E. coli Molecular Weight 14. 9 kDa(Reducing) Purity 95% by SDS PAGE Endotoxin <2EU g Conjugation Unconjugated Tag His Tag Physical Appearance Lyophilized Powder

Product Specification


Species Human
Synonyms Cystatin-C,Cystatin C,Cystatin-3,CST3
Accession P01034
Amino Acid Sequence

Ser27-Ala146, with N-6*His MHHHHHHDDDDKSSPGKPPRLVGGPMDASVEEEGVRRALDFAVGEYNKASNDMYHSRALQVVRARKQIVAGVNYFLDVELGRTTCTKTQPNLDNCPFHDQPHLKRKAFCSFQIYAVPWQGTMTLSKSTCQDA

Expression System E.coli
Molecular Weight 14.9 kDa(Reducing)
Purity

>95% by SDS-PAGE

Endotoxin <2EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer 20mM Tris, 100mM NaCl, pH8.0
Reconstitution Reconstitute at 0.1-1mg/mL according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.

Background

Human cystatin C (hCC) belongs to a family of proteins called cystatins. There are three distinct types of cystatins that share sequence and structure homology but differ in size, site of action, and disulfide bond topology. Human cystatin C belongs to the type 2 cystatins that are generally secreted as extracellular polypeptides. hCC is broadly distributed and found in most body fluids. This small protein consists of 120 amino acids forming a single polypeptide chain. Cystatin C contains four conserved cysteine residues that can form two disulfide bonds but, unlike other family members, was neither shown to be glycosylated (cystatin E/M and cystatin F) nor phosphorylated (chicken cystatin). Furthermore, hCC can be found in monomer, dimer, oligomer, and fibril states.

In terms of biological function, hCC is a target of proteolysis, and primarily functions as a protease inhibitor. It is degraded by cathepsin D and elastase.Uncontrolled proteolysis leads to an imbalance between active proteases and endogenous inhibitors,eventually leading to disease.The hCC concentration in blood correlates with the glomerular filtration rate(GFR), an important marker of kidney health and the progression of diabetes, chronic kidney disease.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 62426405680

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.7 ★★★★★
Based on 15 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
B
Verified Purchase
B Lehman
Port Orchard, US
★★★★★ 5
Great Product. Easy to use.
Color: Black
This is the third running watch I've had and it's my first Timex. I've owned to Casio's before (one being a g-shock), but after finding my g-shock to bulky and cluttered, and loosing my other Casio I picked up from Walmart, I decided to look around to find a new durable running watch. I run cross country and track so going from a generic stopwatch to a 30-lap chrono watch has been sweet. The lap timer is easy to use and the display is big enough to take a glance and see my split and total time side by side. The recall feature works perfectly and you even have some room to adjust the settings to configure your lap display how you like it. My favorite thing about this Timex, is its ease of use. The only time I've had to look at a manual is when I first got the watch. The display updates as you go through the various modes to show you what the new buttons mean so there is never a question on how to set the time or recall your laps. This watch is extremely durable. It has already taken a few shots and I've swam with it on several times. The screen and body have held up nicely and I don't foresee any problems with them in the future. The strap is great also. I really like the notch that keeps the excess strap in place. The countdown timer and the alarm both work as expected. The timer has some different settings and is easy to set up. My only disappointment with the timer was that you can't set different intervals. Like if you want to run for five minutes and walk for two your going to have to invest a little more for a watch that allows different intervals. The alarm works well too, and the beeping successfully wakes me up in the morning, but I'm not a heavy sleeper so some may find it too quiet. Overall this watch is durable, easy to use, and can track splits really well. The watch is a little bulky if you are used to a more minimalist watch but for me the weight was perfect, and for the price you can't go wrong with this watch.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 5, 2013
H
Verified Purchase
Hathi
Port Orchard, US
★★★★★ 4
Trusted Brand Delivers Again
Color: Black/Yellow
I had my previous Timex watch for 30+ years and it finally died after getting wet, so I replaced it with the closest model I could find to it. PROS: - Has the basic functions I needed: Clock, 2nd Time Zone Clock, IndiGlo backlighting, Alarm, Timer, Stopwatch. Allows me to leave phone at home and just take this out. - Easy to set time/date/etc. Can turn alarm on / off easily. Buttons for timer/mode switching work fine. - Clear display so easy to read. The backlighting makes this even better. - Can swap out the band (I put mine on a Chums' "The Band" that I like) if the new one takes 19mm pins. CONS: - The only thing I dislike is it is heavier than my old Timex. A little bulkier too. Not annoyingly so but noticeable enough for me to comment on it here.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on October 20, 2025
P
Verified Purchase
Poorboy5764
Houston, US
★★★★★ 5
Great Timex Watch
Color: Black/Yellow
This Timex Ironman watch arrived on time and is of great quality. I have used these watches for years and have NO complaints about their longevity, accuracy, or dependability. I will definitely purchase again if needed.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 1, 2026
R
Verified Purchase
Rikeshay
Alexandria, US
★★★★★ 5
Item as described.
Color: Dark Blue
A timeless tradition of a great design and useful watch. Have been using this watch design for over a 30 years.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 27, 2026
B
Verified Purchase
Buck
Lowell, US
★★★★★ 5
Great thowback to the OG Ironman, but Amazon's listing gets it undue negativity.
Color: Black/Yellow
Amazon's listing is not very good with it's wording so this watch has gotten undue negative reviews. I've seen this model listed as both the Endure 30 and the Original 30 Shock, it has 1 alarm with 3 different modes (not 3 separate alarms), 200m WR, ISO shock resistance, (reverse) Indiglo with night mode, 2 time zones, 12/24hr time, 30 lap stopwatch, 24hr countdown timer (repeatable), and day/date (MM.DD or DD.MM). Its basically a slightly updated feature set compared to an Ironman 8-lap. This watch is great, it's got the look of the original Ironman 8-lap with modern guts. The only minus for me is it could be a little slimmer on the wrist, but I also didn't realize it was shock resistant when I bought it. For comparison, it is a few mm smaller in all dimensions than a G-Shock G2300/G2310/GW2310 series. The band is similar to G-Shocks in that it is formed/molded around the wrist but like the case it's still slimmer in the way it wears around the wrist. Not as slim as an F91W but not as massive as any G-Shock basically. The module has a better display with bigger numbers than the above mentioned Casios. With the exception of the lap memory, the G23## G-Shocks have more features, but the Endure 30 is much easier to use thanks to the display and larger buttons. If you want 3 alarms you need the very similar Classic 30. The main differences being the Classic has 3 separate alarms (not 1), occasion reminders and 3 time zones but losses the Ironman 8-lap look, the shock resistance and it's only 100m WR. The Classic seems to come in at least two case varieties (chunky or slim), two sizes and many color combinations. If you only need the Endure 30's features but want a different shape/size/style/slimmness, I believe the Essential 10/30 and BASIC Transit models are functionally the same with only different lap memories, WR, and no shock resistance. Unfortunately, Timex doesn't easily identify the actual module used in a watch like Casio, so the best way to figure out what features a watch has is to lookup the watch model on the Timex website. Of course the manuals do not always match the marketing names they have used over the years (Endure/Classic/Essential/etc), and each manual covers a few shapes/sizes of watch but just search for the model number in the manuals sections and you'll eventually find the right one. If no manual pops up right away delete digits from the right end of the model number until a manual is found, I believe those last digits only indicate slight variances in style/color that are not important to functionality.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 31, 2021

recommand products