SKU: 62560761731

Human INOS, His tag

Sale price$123.75 Regular price$137.50
Save 10%

Pay in installments of $34.38 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 29 - Sep 3

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human INOS, His tagProduct Specification Species Human Synonyms Hepatocyte NOS (HEP NOS), Inducible NO synthase (Inducible NOS; iNOS), NOS type II, Peptidyl cysteine S nitrosylase NOS2, NOS2A Accession P35228 Amino Acid Sequence Protein sequence (P35228, Ala2 Cys200, with C 10*His)

Product Specification


Species Human
Synonyms Hepatocyte NOS (HEP-NOS), Inducible NO synthase (Inducible NOS; iNOS), NOS type II, Peptidyl-cysteine S-nitrosylase NOS2, NOS2A
Accession P35228
Amino Acid Sequence

Protein sequence (P35228, Ala2-Cys200, with C-10*His) ACPWKFLFKTKFHQYAMNGEKDINNNVEKAPCATSSPVTQDDLQYHNLSKQQNESPQPLVETGKKSPESLVKLDATPLSSPRHVRIKNWGSGMTFQDTLHHKAKGILTCRSKSCLGSIMTPKSLTRGPRDKPTPPDELLPQAIEFVNQYYGSFKEAKIEEHLARVEAVTKEIETTGTYQLTGDELIFATKQAWRNAPRCGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Predicted MW: 24.2 kDa Observed MW: 43-55 kDa
Purity >90% by SDS-PAGE
Endotoxin <1EU/μg
Tag with C-10*His
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

Nitric oxide synthases (NOSs) are a family of enzymes catalyzing the production of nitric oxide (NO) from L-arginine. NO is an important cellular signaling molecule. It helps modulate vascular tone, insulin secretion, airway tone, and peristalsis, and is involved in angiogenesis and neural development. Nitric oxide is mediated in mammals by the calcium-calmodulin controlled isoenzymes eNOS (endothelial NOS) and nNOS (neuronal NOS). Nitric oxide synthase, inducible (iNOS) is an enzyme which is encoded by the NOS2 gene in humans and mice. INOS involved in immune response, binds calmodulin at physiologically relevant concentrations, and produces NO as an immune defense mechanism. In mice, the function of Nos2 in immunity against a number of viruses, bacteria, fungi, and parasites has been well characterized. Nos2 is important for protective immunity against CMV.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 62560761731

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.2 ★★★★★
Based on 15 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
N
Verified Purchase
N. Narvais
Louisville, US
★★★★★ 5
Items works just as described.
great soap. Lots of suds, no lingering perfumy smell, and seems to last longer than most.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on August 6, 2024
L
Verified Purchase
Lawrence Mills II
Houston, US
★★★★★ 4
2 smell good, 2 not so good and it's made in China
These are interesting soaps. The inverted loofah sponge for the soap is in interesting idea. The black and green ones smell the best. They are made in China however so I'm going with a USA made one next. Dapper Yankee.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on August 18, 2024
K
Verified Purchase
K. Chaves
Waukegan, US
★★★★★ 5
Natural, Gentle, and Smells Great
Style: Most Popular
I picked these up to try something more natural, and I love them. They lather well, feel gentle on the skin, and leave it feeling clean without drying it out. The scents are really nice too. They feel like good quality bars.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 24, 2026
K
Verified Purchase
Kailyn
Lowell, US
★★★★★ 5
Longevity, scent, quality 10/10
Style: Most Popular
I’ve gone through just about the whole box and I will be buying more. I bought these early November 2025 and now that it’s almost May of 2026 I’m down to my last two bars so id say they last awhile. I use them for body wash and will be using them for hand soap once I go through my stash of bar soaps from other brands. It lathers nicely, with a light scent, natural not over bearing chemical scents. I use this as body wash and hand soap. I haven’t noticed any skin irritation, just a good ole natural soap (: I love how there’s no plastic in sight other than maybe amazon packaging
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 23, 2026
B
Verified Purchase
B. Hamlin
Fort Morgan, US
★★★★★ 4
Better than expected...
Style: For Him
I love going to a craft show or a place that sells a handcrafted soap. A good craftsperson can produce a high-quality soap that cleanses, moisturizes, and leaves a good scent. I gave these a shot after running out of those soaps. They did beat my expectations. I thought these would be a factory produced and chemically. While you can tell these are churned out pretty regularly in some sort of factory, the overall quality is good. Each scent is full and unique without being overpowering. They seem to be natural and not generic chemical smells. Really enjoy each of the unique scents. The bars themselves aren't that big. They come in a piece of cardboard and are very uniform. There is some texture to the soap, as well as an added bit of something to give it some grit. I like it. This isn't lava soap but there is something (about the size of fresh ground pepped) mixed throughout each bar. A drawback overall is how long they last. I would estimate less than a week for a daily user. I thought, given the denseness, they would last for a longer than they do. I'll probably use the entire box in under a month. Of note is the lack of slimy or slipperiness to the soap. I like this. Some soaps that I've used in the past leave you slimy and you can barely hang on to the bar. This rinses very well and doesn't make you feel slimy. Overall, these are a good replacement for the 'true' homemade soap. I am happy with them and would purchase them again.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 30, 2020

recommand products