SKU: 63167193307

Human CD36, His tag

Sale price$90.00 Regular price$100.00
Save 10%

Pay in installments of $25.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 29 - Sep 3

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human CD36, His tagProduct Specification Species Human Synonyms Glycoprotein IIIb, PAS IV, PAS 4, Platelet glycoprotein IV Accession A4D1B1 Amino Acid Sequence Protein sequence(A4D1B1, Gln35 Asn439, with C 10*His)

Product Specification


Species Human
Synonyms Glycoprotein IIIb, PAS IV, PAS-4, Platelet glycoprotein IV
Accession A4D1B1
Amino Acid Sequence

Protein sequence(A4D1B1, Gln35-Asn439, with C-10*His)
QKTIKKQVVLEEGTIAFKNWVKTGTEVYRQFWIFDVQNPQEVMMNSSNIQVKQRGPYTYRVRFLAKENVTQDAEDNTVSFLQPNGAIFEPSLSVGTEADNFTVLNLAVAAASHIYQNQFVQMILNSLINKSKSSMFQVRTLRELLWGYRDPFLSLVPYPVTTTVGLFYPYNNTADGVYKVFNGKDNISKVAIIDTYKGKRNLSYWESHCDMINGTDAASFPPFVEKSQVLQFFSSDICRSIYAVFESDVNLKGIPVYRFVLPSKAFASPVENPDNYCFCTEKIISKNCTSYGVLDISKCKEGRPVYISLPHFLYASPDVSEPIDGLNPNEEEHRTYLDIEPITGFTLQFAKRLQVNLLVKPSEKIQVLKNLKRNYIVPILWLNETGTIGDEKANMFRSQVTGKINGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Theoretical:47.7kDa Actual:70-95kDa
Purity >90% by SDS-PAGE
Endotoxin <1EU/μg
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

The CD36 antigen is an integral membrane protein found on the surface of many cell types in vertebrate animals. It imports fatty acids inside cells and is a member of the class B scavenger receptor family of cell surface proteins. CD36 binds many ligands including collagen, thrombospondin, erythrocytes parasitized with Plasmodium falciparum, oxidized low density lipoprotein, native lipoproteins, oxidized phospholipids, and long-chain fatty acids. The protein itself belongs to the class B scavenger receptor family which includes receptors for selective cholesteryl ester uptake, scavenger receptor class B type I (SR-BI) and lysosomal integral membrane protein II (LIMP-II).CD36 has also been implicated in hemostasis, thrombosis, malaria, inflammation, lipid metabolism and atherogenesis.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 63167193307

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.7 ★★★★★
Based on 25 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
H
Verified Purchase
H Klair
Grantham, US
★★★★★ 5
Resourceful!!
Format: Paperback
The book includes multiple full-length SAT practice tests that are same format and difficulty level of the real exam. Book covers questions from all sections—Reading, Writing, and Math Each question is accompanied by a thorough explanation, which will help students learn from their mistakes and improve their test-taking strategies. This is a must have as a study tool to prep for an exam.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 6, 2025
L
Verified Purchase
L.B.
Omaha, US
★★★★★ 5
Great resource!
Format: Paperback, Format: Paperback
This book is a great resource to have when prepping for the SAT. The diagnostic test is a huge help to see where you are before you dive into studying. The five practice tests include in depth explanations of the answers – that is a big help with studying. This is a great way to study for the digital SAT. Highly recommended!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 14, 2025
R
Verified Purchase
R. Ploum
Charlottesville, US
★★★★★ 5
Excellent resource beyond Real Estate investing
Format: Paperback
This book is hands down one of the best resources on key financial terms I have read yet. The authors explain many of the most important concepts in easy-to-understand language, building one’s understanding chapter upon chapter. I have ordered a dozen copies to hand out to my team as a reference guide for our group discussions. Whether you’re a newcomer to the profession and need to build a foundational understanding of the subject matter or are a more seasoned professional but would like a first-class teaching aid to assist in the development of others, this book covers all bases.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 25, 2023
K
Verified Purchase
Kindle Customer
Omaha, US
★★★★★ 5
Great book
Format: Kindle
Great book . I really appreciate the questions at the end of each chapter that you must solve yourself it really makes this book a cut above the other real estate books I’ve read . Thank you
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 19, 2025
S
Verified Purchase
Sandman
Bozeman, US
★★★★★ 5
Excellent Book
Format: Paperback
This book goes into such details of needed formulas and how to use them. Book has lots of examples of real world use and how to use the formulas. Well worth the purchase price.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 27, 2024

recommand products