SKU: 64122152495

ALK-1/ACVRL1 His Tag Protein, Mouse

Sale price$266.40 Regular price$296.00
Save 10%

Pay in installments of $74.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 29 - Sep 3

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

ALK-1/ACVRL1 His Tag Protein, MouseProduct Specification Species Mouse Synonyms SKR3, Activin receptor like kinase 1 (ALK 1), TGF B superfamily receptor type I (TSR I), Acvrl1, Acvrlk1, Alk 1 Accession Q61288 Amino Acid Sequence Asp23 Pro119, with C terminal 8*His DLAKPSKLVNCTCESPHCKRPFCQGSWCTVVLVREQGRHPQVYRGCGSLNQELCLGRPTEFLNHHCCYRSFCNHNVSLMLEATQTPSEEPEVDAHLPGGGSHHHHHHHH Expression System HEK293 Molecular Weight 23 31kDa Purity >95% by SDS PAGE Endotoxin <0. 1EU g Conjugation

Product Specification


Species Mouse
Synonyms SKR3, Activin receptor-like kinase 1 (ALK-1), TGF-B superfamily receptor type I (TSR-I), Acvrl1, Acvrlk1, Alk-1
Accession Q61288
Amino Acid Sequence

Asp23-Pro119, with C-terminal 8*His DLAKPSKLVNCTCESPHCKRPFCQGSWCTVVLVREQGRHPQVYRGCGSLNQELCLGRPTEFLNHHCCYRSFCNHNVSLMLEATQTPSEEPEVDAHLPGGGSHHHHHHHH

Expression System HEK293
Molecular Weight 23-31kDa
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1. Cindy Lora Gil. Bruno Larrivée. Alk1 haploinsufficiency causes glomerular dysfunction and microalbuminuria in diabetic mice. Scientific RepoRtS (2020) 10.

Background

The Bone Morphogenetic Protein (BMP) receptor Activin receptor–like kinase 1 (Alk1), which is predominantly expressed in the vascular endothelium, has been shown to play a critical role in angiogenesis. Embryos lacking Alk1 die early during embryonic development due to impaired vascular remodeling and lack of perivascular cell coverage. In renal physiology, Alk1 has been suggested to play an important role in the regulation of extracellular matrix deposition, including collagen type I and fibronectin, and Alk1 heterozygosity has been associated with increased renal fibrosis in a mouse model of obstructive nephropathy, probably due to the decrease in the Alk1/Smad1 antifibrotic/protective signaling in renal fibroblasts.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 64122152495

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.4 ★★★★★
Based on 22 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
J
Verified Purchase
Jen C
Omaha, US
★★★★★ 5
Good sturdy balls
Size: Medium (2.5"), Style: Fetch Pack 2
My dogs love balls! Unfortunately, they tend to chew them up very quickly. My Belgium Malinois chews on this all the time, and it has held up pretty well. Good option for chewers
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 17, 2026
B
Verified Purchase
Baibhav Bhattarai
Alexandria, US
★★★★★ 5
Fetch Perfection
Size: Medium (2.5"), Style: Fetch Pack 2
If you’re anything like me, fetch is the ultimate game with your furry companion. The Chuckit! Dog Fetch Ball Medley has taken our playtime to the next level with its variety and durability. This 3-pack of medium-sized, ultra-rugged balls is perfect for endless games of fetch without worrying about wear and tear. I love how each ball has a unique texture and color, keeping my dog engaged and excited every time. The medium size is just right for energetic dogs, allowing for long throws and big leaps. Plus, the rugged design means these balls can withstand even the most enthusiastic chewers and rough play sessions, making them a great investment for active pets. However, the vibrant colors can sometimes make them easy to lose in green grass or sandy beaches, but a good game of hide-and-seek with your dog is a small price to pay for such fantastic fetch balls. Additionally, while they’re durable, no ball is completely indestructible, so occasional replacements might be necessary for the most aggressive players. Overall, the Chuckit! Dog Fetch Ball Medley is a must-have for any dog owner looking to enhance their playtime. They’re fun, durable, and keep both you and your dog entertained for hours. A solid 5-star rating for their quality and variety, with a tiny star lost to their occasionally elusive colors.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on October 23, 2024
B
Verified Purchase
Brie
Whiting, US
★★★★★ 5
great ball!
Size: Medium (2.5"), Style: Fetch Pack 2
My pitbull LOVES these. She is a power chewer and tough on balls and toys and tends to go through them insanely quick. She is still on her first ball out of this pack and its been at least two months. It is a little small for her mouth but she doesn’t seem to mind, as it has quickly become one of her favorites. Not a loud ball and it doesn’t usually make that wet chewy noise when shes going to town on it which is huge for me😂😂 Safe for my pittie so i’d imagine a smaller dog would be just fine.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 21, 2026
A
Verified Purchase
Amazon Customer
Charlottesville, US
★★★★★ 5
Border Collie Approved: Easy to Clean, Durable, and Great Bounce
Size: Medium (2.5"), Style: Fetch Pack 2
These are the best balls out there for dogs. These fit great in the chuck-it ball launcher, which we need to wear out my border collie. They fit her mouth properly and, most importantly, do not absorb all the spit or water after a good rain. They are quick to clean off and have good weight so you can let them fly! Furthermore, they bounce well, which is perfect for my dog that likes to catch them on a bounce. The ball is a strong rubber, so should not be easy to chew up. I've used these for years, and the only time I've had to replace them is when one gets lost in the hay field. I highly suggest these as replacements for the common tennis balls.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on July 19, 2025
M
Verified Purchase
maxine
Waukegan, US
★★★★★ 4
Heavy duty.
Size: Medium (2.5"), Style: Fetch Pack 2
My dog was not interested, but it’s a good product
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 11, 2026

recommand products