SKU: 64237993697

Human MCM6, His tag

Sale price$121.50 Regular price$135.00
Save 10%

Pay in installments of $33.75 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 29 - Sep 3

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human MCM6, His tagProduct Specification Species Human Synonyms p105MCM Accession Q14566 Amino Acid Sequence Protein sequence (Q14566, Val676 Asp821, with C 10*His) VDEGAGGINGHADSPAPVNGINGYNEDINQESAPKASLRLGFSEYCRISNLIVLHLRKVEEEEDESALKRSELVNWYLKEIESEIDSEEELINKKRIIEKVIHRLTHYDHVLIELTQAGLKGSTEGSESYEEDPYLVVNPNYLLEDGGGGSHHHHHHHHHH Expression System HEK293 Molecular Weight Predicted MW: 18. 2 kDa Observed MW: 24 kDa Purity 95% by SDS PAGE Tag with C 10*His Physical Appearance

Product Specification


Species Human
Synonyms p105MCM
Accession Q14566
Amino Acid Sequence

Protein sequence (Q14566, Val676-Asp821, with C-10*His) VDEGAGGINGHADSPAPVNGINGYNEDINQESAPKASLRLGFSEYCRISNLIVLHLRKVEEEEDESALKRSELVNWYLKEIESEIDSEEELINKKRIIEKVIHRLTHYDHVLIELTQAGLKGSTEGSESYEEDPYLVVNPNYLLEDGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Predicted MW: 18.2 kDa Observed MW: 24 kDa
Purity >95% by SDS-PAGE
Tag with C-10*His
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

DNA replication licensing factor MCM6 is a protein that in humans is encoded by the MCM6 gene. MCM6 is one of the highly conserved mini-chromosome maintenance proteins (MCM) that are essential for the initiation of eukaryotic genome replication. The MCM complex consisting of MCM6 (this protein) and MCM2, 4 and 7 possesses DNA helicase activity, and may act as a DNA unwinding enzyme. The hexameric protein complex formed by the MCM proteins is a key component of the pre-replication complex (pre-RC) and may be involved in the formation of replication forks and in the recruitment of other DNA replication related proteins. The phosphorylation of the complex by CDC2 kinase reduces the helicase activity, suggesting a role in the regulation of DNA replication. Mcm 6 has recently been shown to interact strongly Cdt1 at defined residues, by mutating these target residues Wei et al. observed lack of Cdt1 recruitment of Mcm2-7 to the pre-RC.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 64237993697

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.3 ★★★★★
Based on 7 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
M
Verified Purchase
Metsa Lintu
Battle Creek, US
★★★★★ 5
It delivered on more levels than I imagined or expected
Color: White
EDIT: I've used this frother pretty much daily, sometimes more than daily, since ordering it, and it has performed very well. I make turmeric/ginger/pepper milk most nights. The way this frother performs for that use astounded me. I bought it for coffee/cocoa/mushroom drinks, then while waiting for it to arrive realized it might work with the "golden milk." First, the little frother uses a closely/precisely applied heat drawing 550w. The thick steel pot nestles down into the heating base, and the cover fits nice and snugly. So I'm not heating an entire thick saucepan perched atop an entire stove burner (1,000-1,500 w), with all the escaped heat that involves. Second, I'm not standing there with thermometer in hand, diving into the open pan of heating milk to find that perfect sweet spot around 150-155...while constantly stirring and making sure not to let it boil over. Because, third, the little frother takes care of that part, with the thermostat auto shut off. Fourth, it whisks the powders smoothly in. Manufacturer suggests starting the whisk movement in the milk, then adding the powders. They did collect a bit in the low vortex around the stem of the little assembly that holds the various whisk/stir/froth blades, but I just stuck a spoon handle in there carefully, and it redistributed easily around the magnetic-driven stirring assembly. And finally, omigosh, the lovely velvety texture! Since these spices express best with extended warming, I'm making one batch, heated and frothed to 160F, then follow that with just milk frothed to 140. While the second batch is running (there's a cool down pause in the process, hastened by rinsing the pot exterior in cold water and of course drying it before putting it on the base), the first batch is steeping the spices...so the combined result is perfect. EDIT: It did its job much faster than I expected (minutes). So I tested it as promised on my "solar generator" backup unit. My thought was that this would make my usual most efficient option for heating milk in those conditions the second most efficient: open saucepan atop a multi-watt-level portable induction cookplace on the 600w setting. And with much less cleanup at a time when water is scarce (electric well pump). We had a power outage here last week. Yep, the 550w frother ran on a Jackery 2000 for the few minutes it took to heat/froth milk--no trouble whatever and hardly put a dent in the charge. WOW. (Technically speaking it could run continuously, continuously heating, for over 3 1/2 hours on a full 2000 kWh charge.) EDIT: This isn't a reduction in stars, just an observation. The frother "tree" assembly that does the business of stirring/whisking/frothing--I thought to order a spare in the event of damage to the original. They are very hard to find online. Maestri House lists the replacement part as "out of stock." Also out of stock, replacement pot and lid. This might be a concern to some considering the tool. But it seems to be well made and I hope gives long service. EDIT: As of May 2026 the little frother is still working exceptionally well on a nearly daily basis. I purchased it in October of 2025, so that shouldn't be a surprise...but just sayin'. :^>
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on October 27, 2025
G
Verified Purchase
Guy Tingos
Alexandria, US
★★★★★ 5
This is the one to get
Color: Black
I find having separate controls for temperature and foam density is critical and this model nails it. The "newer model" listed in the product description eliminates the separate controls and does not function as well. This frother also has nice features such as the ability to produce cold foam and easy cleaning. It is also extremely quiet. I've tried several mid-range electric frothers and this is the best.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 11, 2026
M
Verified Purchase
Mizz Road Runner
Natrona Heights, US
★★★★★ 5
So far. so good.
Color: White
This is my 3rd frother that I purchased from Amazon. The others were brand name frothers that broken within a few months of use. I won't name here (hint: begins with an N and ends with an o) This Milk frother from Maestri however works excellent. Multiple heat and drink settings and makes the perfect foam every time. I especially like how the pitcher is removable from the electric base and can be washed with out worry. easy to use. Just read the manual to understand all the settings, makes a perfect froth in less than 2 minutes. I've only had this for a few weeks but I am impressed.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 11, 2026
L
Verified Purchase
lvs
West Palm Beach, US
★★★★★ 4
Loving it so far!
Color: White, Color: White
02 Nov 2025 I've only used this twice and I already love it. My main reason for buying it is for protein hot chocolate I drink twice a day. I previously made it at the stove and that took 13 minutes of constant mixing to reach 160°. My hot chocolate is 1 cup of milk, 1 tbsp each cacao powder and panela (sugar), 1-2 tbsp collagen powder, vanilla extract, and 1 whole egg. I premix everything before pouring it into the frother because, while it may be able to handle the powders, there's no way that whisk will be able to break the whole egg enough to thoroughly blend it before it starts cooking. I'm totally fine premixing the night before and heating it in the morning. I made the first batch this morning with 2 cups of milk doubling only the cacao and sugar which brought it to just below the top max line, and it came out perfect. It was smooth and there was no burnt taste. I used the recommended hot chocolate attachments, lowest froth setting, and 160° temp setting. I had almost no froth in my hot chocolate which was perfect. I removed the pitcher as soon as it was done to prevent any burning. I checked the temp with a thermometer and the temp was actually 165°. I don't really know if that would impact the taste if there was less milk. For the 2 cups, it was still perfect. I do wish there was a little more temp control like a 150° or 155° setting. I also wish it was able to give you the temp as it was heating in case you want to pull it off just before it hit the set temp. The bottom right button is superfluous. It helps with the foam setting, but you can also simply press each of those buttons directly. Cleaning is super easy, just remove the pitcher and attachments. I love that the attachments are magnetic, but I recommend taking them out before pouring because the magnets aren't that strong. All in all, great for the price and perfect for my needs.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on November 2, 2025
A
Verified Purchase
Amazon Customer
Fort Morgan, US
★★★★★ 5
Epic. Works great.
Color: Black
Works great every day. Super powerful and smooth compared to my old battery powered one. The shaft is much thicker and is more securely positioned so I can't imagine it becoming tweaked off balance like my old one. And it comes with an extra mixer attachment! I imagine I've put that away for a long time, but we'll see. Easy to turn on and off with one hand, but I can imagine it being less easy than a simple push button for someone with decreased thumb dexterity or mobility. I do wish the lowest speed was slightly lower, but it hasn't caused any splashing or other detriment. The speed adjustment is very smooth and power is abundant. Love the stand, Usb c charge port is solid, battery life is excellent.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 13, 2026

recommand products