SKU: 64908869152

Mouse CD90, His tag

Sale price$150.75 Regular price$167.50
Save 10%

Pay in installments of $41.88 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 29 - Sep 3

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Mouse CD90, His tagProduct Specification Species Mouse Synonyms Thy 1 membrane glycoprotein, Thy 1 antigen, Thy1 Accession P01831 Amino Acid Sequence Protein sequence (P01831, Gln20 Cys131, with C His tag) QKVTSLTACLVNQNLRLDCRHENNTKDNSIQHEFSLTREKRKHVLSGTLGIPEHTYRSRVTLSNQPYIKVLTLANFTTKDEGDYFCELQVSGANPMSSNKSISVYRDKLVKC Expression System HEK293 Molecular Weight Predicted MW: 14. 5 kDa Observed MW: 20 27 kDa Purity 95% by SDS PAGE Endotoxin <1EU g Tag with C His tag

Product Specification


Species Mouse
Synonyms Thy-1 membrane glycoprotein, Thy-1 antigen, Thy1
Accession P01831
Amino Acid Sequence

Protein sequence (P01831, Gln20-Cys131, with C-His tag) QKVTSLTACLVNQNLRLDCRHENNTKDNSIQHEFSLTREKRKHVLSGTLGIPEHTYRSRVTLSNQPYIKVLTLANFTTKDEGDYFCELQVSGANPMSSNKSISVYRDKLVKC

Expression System HEK293
Molecular Weight Predicted MW: 14.5 kDa Observed MW: 20-27 kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Tag with C-His tag
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

Thy-1 or CD90 (Cluster of Differentiation 90) is a 25–37 kDa heavily N-glycosylated, glycophosphatidylinositol (GPI) anchored conserved cell surface protein with a single V-like immunoglobulin domain, originally discovered as a thymocyte antigen. Thy-1 can be used as a marker for a variety of stem cells and for the axonal processes of mature neurons. The 162aa (murine, 161 for human) Thy1 precursor has 19 amino acid (aa 1–19) signal sequence and 31 amino acid (aa 132–162) C-terminal transmembrane domain that is present in pro form but removed when transferring the 112 amino acid (aa 20–131) mature peptide to GPI anchor which would attach through the aa 131. Thy-1 can be shed by special types of Phospholipase C e.g. PI-PLC (phosphatidyl-Inositol Phospholipase C, or PLC β). it can also be involved in cell to cell transfer of GPI anchored proteins like CD55 and CD59. It has speculated roles in cell-cell and cell-matrix interactions, with implication in neurite outgrowth, nerve regeneration, apoptosis, metastasis, inflammation, and fibrosis. It has also been proven to be a tumor suppressor for some tumors. In case of prostate cancer it has been shown to be expressed in cancer associated stroma but not in normal stroma and has been suggested to be of potential help for cancer specific drug targeting.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 64908869152

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.3 ★★★★★
Based on 9 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
L
Verified Purchase
LM271891
Lexington, US
★★★★★ 5
Just right grill cover
Size: 70 Inch, Color: black, Size: 70 Inch, Color: black
We just got a new grill that was quite wide. It can use propane on one side and charcoal on the other. While looking at covers I noticed many were priced well over $50. This one was not and I decided to try it. It’s a fantastic cover for our grill. It’s hem is sewen solid and the material is thick, and water proof. The size is perfect for my grill and I love the Velcro sides to keep water out during our Florida rain storms. I am very happy with my purchase.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 19, 2026
J
Verified Purchase
John
Omaha, US
★★★★★ 5
Great cover!!
Size: 55 Inch, Color: black, Size: 55 Inch, Color: black
Best grill cover I've purchased. One year old, looks brand new! Last one was an expensive Cuisinart one. Two years and it was ripping to shreds from sun damage. In the pic, the smaller cover is a Cuisinart cover on an electric smoker and you can see it's faded to white on the top and not gonna last much longer! This grill cover looks and feels brand new! Sits in the sun everyday.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 25, 2026
C
Verified Purchase
CWT
Fort Morgan, US
★★★★★ 5
Awesome cover worth the money
Size: 55 Inch, Color: black
Nice and heavy duty. Been a heavy rain season this year and this cover is a champ. It's thick and easy to use. Did my cheapo nexgrill 5 burner perfectly.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 29, 2026
G
Verified Purchase
GM
Grantham, US
★★★★★ 5
I got 6 years use out of it and just re-ordered a new one! Best grill cover I’ve ever purchased.
Size: 50 Inch, Color: black, Size: 50 Inch, Color: black
Very durable! I noticed earlier this spring that mine was starting to rip after several strong spring wind storms. I knew I had had it for several years but I wasn’t sure how long. I went in my orders page and saw that I ordered it back in 2020 so I got 6 years out of it!! Note that it stays outside on the deck all year round, and that includes during Northeast US winters with frigid temperatures and snow and I only now started to see the tears in it this spring. The tear started at the top of the grill, and actually started falling apart more after I touched it. Refer to the attached photos of mine after 6 years. I think it’s very durable for sitting outside for 6 years and only now only starting to show wear . You can also see how it didn’t really fade despite getting full afternoon sunlight. The velcro ties at the bottom,are also a plus as far as getting it to stay in place and not blow off. That’s why I definitely just repurchased the same one. Hopefully, I will get at least 6 years out of the new one when it arrives tomorrow.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 26, 2026
S
Verified Purchase
Scott B.
Alexandria, US
★★★★★ 5
Water Shoes for 3-Week Trip to Amazon, Machu Picchu and the Galapagos
Size: 10.5, Color: Blue/Grey
Bought these shoes (along with a pair of Merrell Gore-TEX Moab Speed 2 GTX) for a three-week trip through some pretty eclectic weather and terrain. I selected these over some much more expensive brands and was very happy with my decision. I typically wear a size 11 athletic shoe (I measure a 10.5), but the 11–11.5 Humtto shoes were way too large and good not get a good fit. I returned that pair, and downsized to the 10.5. They fit me perfectly. Before leaving on the trip I used them to work out at the gym and do some light hiking. They were first seriously tested in the Amazon. The soles provide pretty darn good traction, and they can be worn with or without socks. Because of their hiking and quick drying capabilities, I ended up using these shoes about 50% of the trip. They look great, are comfortable, can be adjusted for fit, and have a decent (medium) arch and heel padding. They are not zero drop from heel to toe, but pretty close. The EVA midsole and memory foam insole for cushioning is great, but do not make the mistake I made by heating it on a heater to accelerate drying. It warped the insole a bit (they are still usable). These are great and survived some pretty extensive testing throughout Peru and Ecuador. If you are stepping into some pretty questionable conditions, these sure are a great back up to your hiking shoes when it may get sloshy and dry shoes are required for the next day.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 3, 2026

recommand products