SKU: 65008202486

Human LECT2, His tag

Sale price$175.50 Regular price$195.00
Save 10%

Pay in installments of $48.75 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 25 - Aug 30

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human LECT2, His tagProduct Specification Species Human Synonyms Leukocyte cell derived chemotaxin 2, LECT 2, hLECT2 Accession O14960 Amino Acid Sequence Protein sequence (O14960, Gly19 Leu151, with C 10*His) GPWANICAGKSSNEIRTCDRHGCGQYSAQRSQRPHQGVDILCSAGSTVYAPFTGMIVGQEKPYQNKNAINNGVRISGRGFCVKMFYIKPIKYKGPIKKGEKLGTLLPLQKVYPGIQSHVHIENCDSSDPTAYLGGGGSHHHHHHHHHH Expression System HEK293 Molecular Weight Predicted MW: 16. 3 kDa Observed MW: 18 kDa Purity 95% by SDS PAGE

Product Specification


Species Human
Synonyms Leukocyte cell-derived chemotaxin-2, LECT-2, hLECT2
Accession O14960
Amino Acid Sequence

Protein sequence (O14960, Gly19-Leu151, with C-10*His) GPWANICAGKSSNEIRTCDRHGCGQYSAQRSQRPHQGVDILCSAGSTVYAPFTGMIVGQEKPYQNKNAINNGVRISGRGFCVKMFYIKPIKYKGPIKKGEKLGTLLPLQKVYPGIQSHVHIENCDSSDPTAYLGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Predicted MW: 16.3 kDa Observed MW: 18 kDa
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Tag with C-10*His
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

Leukocyte cell-derived chemotaxin-2 (LECT2) is a chemotactic factor for neutrophils. Subsequent studies have defined LECT2 as a hepatokine. LECT is an evolutionary conserved protein, has one or more important functions, and may be involved in various diseases. Human LECT2 is a secreted, 16 kilodalton protein. Its structure is similar to that of the M23 family of metalloendopeptidases. LECT2 has not been found to possess enzymatic activity and does not appear to share any functions with M23 metalloendopeptidases. The liver hepatocyte is considered to be the source of the LECT2 circulating in blood. Several cell types or tissues, e.g. osteoblasts, chondrocytes, cardiac tissue, gastrointestinal smooth muscle cells, and epithelial cells of some tissues normally do not express LECT2 but do so under a variety of disease conditions. LECT2 amyloidosis (ALECT2) was the common (~3% of total) cause of amyloidosis. Circulating levels of LECT2 are elevated in >90% of individuals with hepatoblastoma and >20% of individuals with Hepatocellular carcinoma. In the latter form of liver cancer, LECT2 levels increase with increasingly poor prognostic stages of the disease and therefore may prove to be valuable prognostic markers.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 65008202486

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.4 ★★★★★
Based on 24 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
A
Verified Purchase
Amazon Customer
Pawtucket, US
★★★★★ 4
I like this book
Format: Hardcover
I like how this book made you look at things differently and made you understand you're self in ways you never had before and be fine with what you saw. theirs always been more then one way to be and their always will be. this book also let's you be fine with not socializing if that's how you feel
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 17, 2026
J
Verified Purchase
Joseph Austin
Omaha, US
★★★★★ 5
There All Along
Format: Kindle
It all came about on a recent trip to Mexico after my wife of ten years forwarded an article about Dr Kaminski’s discovery of a new personality type. Interested, I dove in to find everything that I read resonated deeply. I looked up the book and bought the Kindle version and it’s been un-put-down able since. My life hasn’t been without a struggle here and there. The short version is that I put myself through Boise State in their accounting program, did well, and then graduated in ‘89. Don’t laugh, my parents thought it would be good if there was an accountant out there with “personality.” It was a bad idea but I didn’t want to do something beneath me like paint houses or be a mechanic. So I gave in. There was an immediate price to pay. My long time girlfriend broke up with me because she wanted us to be more and I felt I had to focus on school and work. I had decent grades despite my shattered heart and my professors were fairly supportive of me. I received an attractive offer to work in a regional firm but it turned out I not only didn’t like the work but even worse, I couldn’t do it. In practice nothing made sense. Balance sheets wouldn’t balance. Income statements wouldn’t reconcile with sales and closing the books was hell. It all seemed so unlike the problems in my textbooks. So I continued working in the grocery store for a few more years. Then in 1992, I met a girl, you know “the one.” Because she was pretty and actually returned my call, I had to have her like she was a possession. So we dated and got married and I sat for and passed the CPA exam and went on to work as an auditor for the State of Idaho which is a lot of fact checking and report writing. In true fashion I tired of the politics and mostly just having a boss. Time marched on. We had kids. She knew she’d found her sucker. I quit my job, opened a private practice specializing in bookkeeping and taxes, neither of which I was very good at. I was good at trying to keep my infinitely narcissistic wife happy keeping up with the Joneses and all the appearances. Through utterly pathetically and foolish means. I got in over my head and embezzled from a client which was discovered although I was never prosecuted, which I correctly predicted. So it’s complicated and I always wondered why I would do such a thing. The answer is elusive, and obviously it was an unbelievably stupid thing to do but I feel I did it either as a cry for help or because I thought my ex wife was worth doing something so wrong. I think I wanted to get caught so I could get my life right at some point. I’ve gone with the cry for help answer because no one is worth stealing for. After $75,000 in child support (which was artificially high due basically to what amounted to extortion from my lovely ex wife - she found out I embezzled to hang on to her then weaponized it against me) and repaying the client I stole from, I started working as a solo painting contractor and never looked back. Life got good for me after I straightened out and became who I am. My second wife believed in me and supported me unconditionally. We’re retired now and are moving to Mexico this summer. 2026 I’m now 61, took the test, my score 227/280. Undeniably an Otrovert.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 2, 2026
J
Verified Purchase
Jean
Lowell, US
★★★★★ 5
Life changing and immensely comforting
Format: Kindle
A well written and descriptive book on a topic that I had never seen before but described me to a T. This book lead to great clarity about why I feel the way I do, how to embrace the positives, and best of all, how to navigate a world where I am different from most through peace and empowerment. An excellent read even if these traits don't apply to you, as understanding the inner workings of others and allowing each to be his/her own person is where we learn to live in harmony. Excellent book.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 14, 2026
C
Verified Purchase
Charles M Myers
Lake Worth, US
★★★★★ 5
Interesting and informative
Format: Hardcover
Somewhat contrarian to traditional thinking
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 24, 2026
A
Verified Purchase
A Reader
Fort Morgan, US
★★★★★ 3
Not a new personality type -- one of the 16 Myers Briggs types
Format: Kindle
The author claims to have identified a personality type that differs from the 16 types identified in the Myers Briggs Type Indicator (MBTI). Among those 16 MBTI types, 8 are extraverts and 8 are introverts. The author refers to those 8 introvert types as a single personality category, and then he tries to differentiate them from the type he proposes: the Otrovert. However, his description of the Otrovert is a detailed, accurate description of one of the 8 Myers Briggs introvert types: the INTJ. So he has not identified a new personality type; he has simply isolated one of the 16 MBTI types and elaborated on it. He does an excellent job of explaining the nuances of the INTJ personality, but he has not identified something new. I would have rated this book 5 stars if it had been presented as a closer look at the INTJ type. The book "Type Talk" by Kroeger and Theusen is the preeminent authority on the MBTI, written by people who qualify instructors to administer the MBTI instrument--find it on Amazon at this link: https://www.amazon.com/Type-Talk-Personality-Types-Determine/dp/0440507049/ref=sr_1_1?
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on September 10, 2025

recommand products