SKU: 66107966938

LAG-3 GST Tag Protein, Human

Sale price$243.00 Regular price$270.00
Save 10%

Pay in installments of $67.50 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 26 - Aug 31

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

LAG-3 GST Tag Protein, HumanProduct Specification Species Human Antigen LAG 3 Synonyms LAG 3,CD223 Antigen, Protein FDC, CD223, FDC, sLAG 3 Accession P18627 Amino Acid Sequence Leu23 Leu450, with N terminal GST Tag

Product Specification


Species Human
Antigen LAG-3
Synonyms LAG-3,CD223 Antigen, Protein FDC, CD223, FDC, sLAG-3
Accession P18627
Amino Acid Sequence

Leu23-Leu450, with N-terminal GST Tag

MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKGGGSGGGSDDDDKLQPGAEVPVVWAQEGAPAQLPCSPTIPLQDLSLLRRAGVTWQHQPDSGPPAAAPGHPLAPGPHPAAPSSWGPRPRRYTVLSVGPGGLRSGRLPLQPRVQLDERGRQRGDFSLWLRPARRADAGEYRAAVHLRDRALSCRLRLRLGQASMTASPPGSLRASDWVILNCSFSRPDRPASVHWFRNRGQGRVPVRESPHHHLAESFLFLPQVSPMDSGPWGCILTYRDGFNVSIMYNLTVLGLEPPTPLTVYAGAGSRVGLPCRLPAGVGTRSFLTAKWTPPGGGPDLLVTGDNGDFTLRLEDVSQAQAGTYTCHIHLQEQQLNATVTLAIITVTPKSFGSPGSLGKLLCEVTPVSGQERFVWSSLDTPSQRSFSGPWLEAQEAQLLSQPWQCQLYQGERLLGAAVYFTELSSPGAQRSGRAPGALPAGHL


Expression System HEK293
Molecular Weight 75-80kDa (Reducing)
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag GST Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1.Colin G. Graydon, Shifa Mohideen and Keith R.Fowke, LAG3’s Enigmatic Mechanism of Action. Frontiers in Immunology

Background

LAG3 is a member of the immunoglobulin superfamily and a CD4 ancestral homolog, resulting from a gene duplication event. Like CD4, LAG3 binds MHC class II (MHCII), but also FGL-1,α-synuclein fibrils (α-syn) and the lectins galectin-3 (Gal-3) and lymph node sinusoidal endothelial cell C-type lectin (LSECtin). As an immune checkpoint, LAG3 inhibits the activation of its host cell and generally promotes a more suppressive immune response. On T cells, LAG3 reduces cytokine and granzyme production and proliferation while encouraging differentiation into T regulatory cells.


Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 66107966938

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.8 ★★★★★
Based on 18 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
G
GV
Lexington, US
★★★★★ 4
Thoughtful Easter devotional, though the writing style may not resonate with everyone
Format: Paperback, Format: Paperback
As Easter approaches, I was interested in spending some time with this devotional. One thing I appreciated right away is how Paul David Tripp connects passages from across the Bible to the deeper meaning of Easter. The devotional begins with references in the Old Testament and traces the thread of prophecy forward toward the ultimate sacrifice and resurrection. That connection between early scripture and the events of Easter is an important foundation of the Christian story, and the book highlights it well. What I liked: Carefully selected Bible passages that connect Old Testament prophecy with the Easter story A devotional structure that encourages reflection throughout the season An accessible way to revisit the narrative from prophecy to resurrection Where it didn’t fully connect for me: The author’s narrative style may be a matter of personal preference. His writing is often elegant and reflective, but at times it felt somewhat fragmented or incomplete to me. I personally tend to connect more with a slightly more straightforward, conversational style of devotional writing. That said, this doesn’t mean the book lacks value. Readers who appreciate a more poetic or contemplative tone may find it quite meaningful. Overall: Even though the writing style wasn’t a perfect fit for me, this is still a worthwhile Easter devotional. It provides a thoughtful way to reflect on the journey from prophecy to resurrection and would make a good companion for the Easter season.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 8, 2026
A
Amazon Customer
Los Angeles, US
★★★★★ 5
Equally deep and approachable devotional
Format: Paperback
This really is an everyday devotional in that it is rich and engaging whether going through it for the Lenten season or any other time of the year. It focuses on the Gospel message from our sin and need for a Savior, through the Lord’s redemptive plan and faithful fulfillment through Jesus. Each daily entry is just two pages, but has a balance of depth and approachability that makes it feel full and spiritually satisfying. The author’s personal stories and way of framing the biblical passages is relatable, and I was immediately drawn into it. I especially like how the devotional begins with the Old Testament scriptures, revealing themes and prophetic pictures that I hadn’t seen before, and then gradually works into the New Testament, even through Revelation! If going through this during Lent, the topics build up the anticipation for Resurrection Sunday and are arranged very meaningfully. The reflection questions are also really good at bringing out deep reflections and a personal response to the biblical passage and thematic focus of the devotional. I’ve made it through most of the devotional at this point, and am thoroughly enjoying it. Highly recommend!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 16, 2026
M
Mikai
Grantham, US
★★★★★ 5
Love this!
Format: Paperback
I recently received this christian daily devotional book and here’s my quick thoughts on it: I think that the condition of the book is great and it doesn’t feel cheap or like it would rip very easily. I think this is a good quality paper and material. I admire this daily devotional book because it is something great to read as soon as you wake up, preparing your day under Christs’ armor. I actually have another daily devotional book which is a year long and it gives encouragement through scripture directly from the word of God. That book is great and it’s amazing reading as soon as I wake up every morning. This book is nothing short of how good that one is and I just love how this one is structured. Overall, I highly recommend this every day Christian devotional book to anyone looking for one and even as a gift for someone! I love this!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 12, 2026
M
Matthew 6:20
Carnegie, US
★★★★★ 5
A Beautiful, Gospel-Filled Devotional for Every Season
Format: Paperback
I have truly been enjoying reading Everyday Gospel Easter Devotional and applying the teachings to my own life. This devotional has been so helpful in fueling my faith and deepening my understanding of the incredible gift that Jesus gave us all on the cross. What I really love is that this isn’t something you can only use during Easter. It can absolutely be read and treasured year-round. The lessons are rich, meaningful, and rooted deeply in Scripture. It begins with teachings from Genesis and ends with Revelation, so you really get to journey through the Bible from beginning to end. I’ve learned so much and gained fresh insight into God’s redemptive plan throughout Scripture. This devotional is perfect for babes in Christ as well as those who are mature in the faith. It presents biblical truth in a way that is easy to understand, yet still powerful and spiritually enriching. I would definitely recommend this devotional to anyone wanting to grow deeper in their faith and better understand the Gospel message. It’s a beautiful reminder of the hope we have in Christ.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 3, 2026
T
Verified Purchase
Ty Spears
Omaha, US
★★★★★ 5
Works great, easy to assemble.
Size: 2 Tier-9.5''Wx10.5''Dx9.5''H
I bought this to try and contain our cabinet clutter. It works really well. Was easy to assemble. I use it on the countertop instead of inside of the cabinets. Looks nice enough to sit out. Will buy 1 more in the coming days. The storage areas pull out, makes for easy access.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 16, 2026

recommand products