Pay in installments of $59.00 with
,
and
Shipping Estimate
USA
- USA
- CAN
- USA
- CAN
Ships within 48 hours · Estimated delivery Sep 2 - Sep 7
Promo Codes Available:
For Your Every Summer RSVP, with Code: SUMMER15
Description
BMPRIA/ALK-3 His Tag Protein, MouseProduct Specification Species Mouse Antigen ALK 3 BMPRIA Synonyms 10q23del; ACVRLK3; ALK3 Accession Q9BXN2 Amino Acid Sequence Gln24 Arg152, with C terminal 8*His QNLDSMLHGTGMKSDLDQKKPENGVTLAPEDTLPFLKCYCSGHCPDDAINNTCITNGHCFAIIEEDDQGETTLTSGCMKYEGSDFQCKDSPKAQLRRTIECCRTNLCNQYLQPTLPPVVIGPFFDGSIRGGGSHHHHHHHH Expression System HEK293 Molecular Weight 20 28kDa (Reducing) Purity >95% by SDS PAGE Endotoxin <0. 1EU g Conjugation Unconjugated Tag His Tag
Product Specification
| Species | Mouse |
| Antigen | ALK-3/BMPRIA |
| Synonyms | 10q23del; ACVRLK3; ALK3 |
| Accession | Q9BXN2 |
| Amino Acid Sequence | Gln24-Arg152, with C-terminal 8*His QNLDSMLHGTGMKSDLDQKKPENGVTLAPEDTLPFLKCYCSGHCPDDAINNTCITNGHCFAIIEEDDQGETTLTSGCMKYEGSDFQCKDSPKAQLRRTIECCRTNLCNQYLQPTLPPVVIGPFFDGSIRGGGSHHHHHHHH |
| Expression System | HEK293 |
| Molecular Weight | 20-28kDa (Reducing) |
| Purity | >95% by SDS-PAGE |
| Endotoxin | <0.1EU/μg |
| Conjugation | Unconjugated |
| Tag | His Tag |
| Physical Appearance | Lyophilized Powder |
| Storage Buffer | PBS, pH7.4 |
| Reconstitution | Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation. |
| Stability & Storage | · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃. · 3 months, -20 to -80℃ under sterile conditions after reconstitution. · 1 week, 2 to 8℃ under sterile conditions after reconstitution. · Please avoid repeated freeze-thaw cycles. |
| Reference | 1.Proc Natl Acad Sci U S A. 2002 Mar 5;99(5):2878-83. Epub 2002 Feb 19. |
Background
Activin receptor-Like Kinase 3 (ALK-3), also known as Bone Morphogenetic Protein Receptor, type IA (BMPR1A), is a type I receptor for bone morphogenetic proteins (BMPs) which belong to the transforming growth factor beta (TGF-β) superfamily. The bone morphogenetic protein (BMP) receptors are a family of transmembrane serine/threonine kinases that include the type I receptors BMPR1A (this protein) and BMPR1B and the type II receptor BMPR2. ALK-3 plays an essential role in the formation of embryonic ventral abdominal wall, and abrogation of BMP signaling activity due to gene mutations in its signaling components could be one of the underlying causes of omphalocele at birth.
Shipping Notes
- Free Standard Shipping on $100+ Orders to the USA.
- Except Preorder products are shipped in 48 hours.
- Delivery to the USA:
- Standard Shipping : 3-10 business days
- If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
- We offer a 30-day return/exchange service after receiving.
- Final sale items are not eligible for returns or exchanges.
- To process your return/exchange, please contact us at [email protected]
- Please click here for more details>>> Return & Exchange Policy