SKU: 67630778953

Human Galectin-3, His tag

Sale price$90.00 Regular price$100.00
Save 10%

Pay in installments of $25.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 29 - Sep 3

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human Galectin-3, His tagProduct Specification Species Human Synonyms 35 kDa lectin, Carbohydrate binding protein 35 (CBP 35), Galactose specific lectin 3, Galactoside binding protein (GALBP), IgE binding prtein, LGALS3, MAC2 Accession P17931 Amino Acid Sequence Protein sequence(P17931, Ala2 Ile250, with C 10*His)

Product Specification


Species Human
Synonyms 35 kDa lectin, Carbohydrate-binding protein 35 (CBP 35), Galactose-specific lectin 3, Galactoside-binding protein (GALBP), IgE-binding prtein, LGALS3, MAC2
Accession P17931
Amino Acid Sequence

Protein sequence(P17931, Ala2-Ile250, with C-10*His)
ADNFSLHDALSGSGNPNPQGWPGAWGNQPAGAGGYPGASYPGAYPGQAPPGAYPGQAPPGAYPGAPGAYPGAPAPGVYPGPPSGPGAYPSSGQPSATGAYPATGPYGAPAGPLIVPYNLPLPGGVVPRMLITILGTVKPNANRIALDFQRGNDVAFHFNPRFNENNRRVIVCNTKLDNNWGREERQSVFPFESGKPFKIQVLVEPDHFKVAVNDAHLLQYNHRVKKLNEISKLGISGDIDLTSASYTMIGGGGSHHHHHHHHHH

Expression System E.coli
Molecular Weight Theoretical: 27.8kDa Actual: 28kDa
Purity

>95% by SDS-PAGE

Endotoxin <1EU/μg
Conjugation Unconjugated
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

· 12 months from date of receipt, -20 to -70 °C as supplied. 
· 6 months, -20 to -70 °C under sterile conditions after reconstitution.
· 1 week, 2 to 8 °C under sterile conditions after reconstitution.  
· Please avoid repeated freeze-thaw cycles.

Background

Galectin-3 is a member of the lectin family, of which 14 mammalian galectins have been identified. Galectin-3 is approximately 30 kDa and, like all galectins, contains a carbohydrate-recognition-binding domain (CRD) of about 130 amino acids that enable the specific binding of β-galactosides. Galectin-3 (Gal-3) is also a member of the beta-galactoside-binding protein family that plays an important role in cell-cell adhesion, cell-matrix interactions, macrophage activation, angiogenesis, metastasis, apoptosis. Galectin-3 is increasingly being used as a diagnostic marker for different cancers. It can be screened for and used as a prognostic factor to predict the progression of the cancer. Galectin-3 has varying effects in different types of cancer. One approach to cancers with high galectin-3 expression is to inhibit galectin-3 to enhance treatment response.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 67630778953

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.8 ★★★★★
Based on 12 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
J
Verified Purchase
jman995x
Lowell, US
★★★★★ 5
Great way to connect my Ethernet to my MacBook Pro....
Size: USB C to Ethernet Adapter
Needed to direct connect to my Modem / Router, but my MacBook Pro, being more modern, and slimmer, doesn't have an Ethernet port anymore (thank goodness). This worked perfectly; just plugged it in and ripped...definitely Plug-n-Play for my Mac. Quality is good (what else do you expect from Anker).
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 21, 2026
B
Verified Purchase
Ben
Belleville, US
★★★★★ 5
Easy to use Plug and Play
Size: USB C to Ethernet Adapter
The item works great. I was having issues with video conference calls even with strong wifi in my house. I bought this adapter due to my HP laptop not having an Ethernet port. This worked great right out of the box. It was detected automatically and as soon as I plugged the Ethernet cable into the adapter, my laptop immediately switched over to that and my internet became more stable.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 8, 2026
B
Verified Purchase
Brandon Huber
Battle Creek, US
★★★★★ 4
It's functional but not as fast as I expected.
Size: USB C to Ethernet Adapter
For Android phone Samsung Flagship Galaxy Series phones... at best getting 136 Mbps, which is 0.136 Gbps. But it is working and allowing me to transfer files within my network. No where near a Gigabit transfer. I will likely keep it because I have another use case for it (a faulty Ethernet on a laptop) and don't get me started with the abyssal wifi speeds on laptops. This deserves at best 4 stars.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 24, 2026
M
Verified Purchase
Maria Cross
Draper, US
★★★★★ 5
Great item
Size: USB C to Ethernet Adapter
Works like a charm. Easy set up.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 21, 2026
M
Verified Purchase
M&M
Louisville, US
★★★★★ 5
Overkill In A Good Way
Size: 1.5FT, Size: 1.5FT
Bought this UGREEN Cat 8 Ethernet cable to connect my router to my modem, and it works perfectly. Build quality is excellent — thick braided but bendable cable, solid connectors, and it clicks in snug. Definitely feels more durable than the cheap cables you usually get. Speeds are stable with no drops or lag, and setup was plug-and-play. The 1.5 ft length is perfect for short runs and keeps everything looking neat instead of having extra cable everywhere. Is Cat 8 probably more than most people need? Yeah, as it is more than enough for home internet speeds of 1 to 2 gigs. But for its value, it’s nice to know it’s future-proof for many homeowners and the speeds currently offered by today’s ISPs. Would absolutely buy again.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 31, 2026

recommand products