SKU: 68415478494

Mouse CXCL10/IP-10/CRG-2 Protein

Sale price$123.75 Regular price$137.50
Save 10%

Pay in installments of $34.38 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 30 - Sep 4

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Mouse CXCL10/IP-10/CRG-2 ProteinProduct Specification Species Mouse Synonyms C X C motif chemokine 10, 10 kDa interferon gamma induced protein (Gamma IP10; IP 10), C7, Interferon gamma induced protein CRG 2, Small inducible cytokine B10, Crg2, Ifi10, Inp10, Scyb10 Accession P17515 Amino Acid Sequence Protein sequence (P17515, Ile22 Pro98) IPLARTVRCNCIHIDDGPVRMRAIGKLEIIPASLSCPRVEIIATMKKNDEQRCLNPESKTIKNLMKAFSQKRSKRAP Expression System HEK293 Molecular Weight Predicted MW: 8. 7 kDa

Product Specification


Species Mouse
Synonyms C-X-C motif chemokine 10, 10 kDa interferon gamma-induced protein (Gamma-IP10; IP-10), C7, Interferon-gamma induced protein CRG-2, Small-inducible cytokine B10, Crg2, Ifi10, Inp10, Scyb10
Accession P17515
Amino Acid Sequence

Protein sequence (P17515, Ile22-Pro98) IPLARTVRCNCIHIDDGPVRMRAIGKLEIIPASLSCPRVEIIATMKKNDEQRCLNPESKTIKNLMKAFSQKRSKRAP

Expression System HEK293
Molecular Weight Predicted MW: 8.7 kDa Observed MW: 10 kDa
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag No Tag
Physical Appearance Lyophilized Powder
Storage Buffer

Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.

Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

C-X-C motif chemokine 10 is a small cytokine belonging to the CXC chemokine family. CXCL10 is secreted by several cell types in response to IFN-γ. These cell types include monocytes, endothelial cells and fibroblasts. CXCL10 has been attributed to several roles, such as chemoattraction for monocytes/macrophages, T cells, NK cells, and dendritic cells, promotion of T cell adhesion to endothelial cells, antitumor activity, and inhibition of bone marrow colony formation and angiogenesis. This chemokine elicits its effects by binding to the cell surface chemokine receptor CXCR3. CXCL9, CXCL10 and CXCL11 have proven to be valid biomarkers for the development of heart failure and left ventricular dysfunction, suggesting an underlining pathophysiological relation between levels of these chemokines and the development of adverse cardiac remodeling.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 68415478494

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.4 ★★★★★
Based on 21 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
N
Verified Purchase
nicole
San Leandro, US
★★★★★ 5
Excellent customer service and quality
Size: Super King, Size: Super King
Update: since my original review the company has reached out to me and apologized for the quality of the comforter i received. They replaced the comforter with a brand new one and didn't make me send back the old one either! This new one is great quality so i am very pleased. The comforter is super comfy and not too hot or too cold. It has some weight to it which i love because it makes it so much more cozy without making me too hot. I got the super king size and I love how big it is. My husband and i don't fight over the covers anymore. With this new comforter and the way they handled things i give this company and product 5 stars and would highly recommend this to anyone! Well, I just opened this comforter and already im finding issues. There are strings coming out and at least 2 stains I've found so far. Not sure if I should return this or what as I'm sure it would be really hard to fit this back into the case. Wish this was a better experience. This was very expensive too, so very disappointing.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 20, 2026
D
Verified Purchase
Drew
Los Angeles, US
★★★★★ 5
Love this comforter.
Size: Queen
Super comfortable and light and well worth the price. Excellent quality that I didn't think I'd find again. And without the dreaded returns of trying something and it not right. It feels like the same one I bought in 2007 at BB&B on Christmas Day for half off and that was $250. So normally a $500 comforter and as a matter of fact I still have it although the feathers are kind of falling out. I'll probably just need to take it to a seamstress and have her resell a few things but I'm still keeping that as I am going to keep this. Incredible feel and very warm for an L2. The design is great. I haven't washed it yet but on order to fluff it I basically put it in the dryer for an hour on delicates with no heat. It did come sealed in a small box but it was absolutely perfect after an hour on fluff with no heat. I will end up buying another one when I get a king size bed. All I need now is a duvet that feels just like this comforter. There was no scent as some people mentioned. It smelled fresh right out of the box.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 20, 2025
K
Verified Purchase
Kalisha
Lowell, US
★★★★★ 5
Update: replacement comforter is much better… really impressed with this small business
Size: Palatial King
Update: The comforter on my bed is now everything I hoped for: fluffy, warm, and wonderfully cozy. Getting here was a two-part story, and it’s the happy ending and the fantastic service that created it that I really want to share. I’ll be honest, my first comforter was a letdown. It arrived flat and thin and just never really… fluffed into the cozy cloud I was hoping for. I was pretty frustrated, which is why I left my original review. But then, something really nice happened. The company actually reached out to me directly. They were so kind, listened without getting defensive, and genuinely wanted to make it right. They sent a replacement, no questions asked, and the difference has been night and day. This new one is exactly what I’d imagined. It has a real, fluffy loft, it’s softer, and after letting it settle, it’s become the full, warm, and comfortable comforter I wanted from the start. My quick takeaways: · A small business that stands behind their work. This meant a lot. · Customer service was top-notch kind, FAST, and professional. · The replacement is clearly better quality: fuller, softer, and warmer. · It’s a completely different (and better) experience than the first. I really value when a company just focuses on fixing things. The way they handled this completely changed my perspective. While the first one missed the mark, their response and the quality of the replacement have made me a happy customer. I’m glad I gave them the chance to make it right, and I’m finally cozy under the comforter I was hoping for.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 10, 2026
C
Verified Purchase
Clyde D Triplett
Houston, US
★★★★★ 5
Very Nice Comforter
Size: King
So far, very happy with my purchase, (King size comforter). Just received yesterday, unpackaged and put inside my duvet, then realized the instructions recommend you place it in the dryer, (as it comes vacuum packed). I really didn’t feel like messing with the duvet again and yet the comforter still fluffed out very nice. The outer shell is very soft, it has decorative piping around the edges and the filling is evenly spread out throughout all the pockets. One of the nicest features are the tabs, located on all four corners and in the middle of each side, (to tie to the inside of your duvet, if your duvet has the little inner strings) great for keeping the comforter in place.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 24, 2026
E
Verified Purchase
Emily K. O'Neill
Massapequa, US
★★★★★ 4
Just one con…
Size: Palatial King
Loved everything about this duvet: great quality, true-to-size, 8 ties and REALLY big & fluffy. It was just way too warm for us, even during the winter. Wish we could find a duvet this full that was cooler.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 6, 2026

recommand products