SKU: 68455990498

Human CXCL9/MIG, His tag

Sale price$105.75 Regular price$117.50
Save 10%

Pay in installments of $29.38 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 31 - Sep 5

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human CXCL9/MIG, His tagProduct Specification Species Human Synonyms Gamma interferon induced monokine, Monokine induced by interferon gamma (HuMIG; MIG), Small inducible cytokine B9, CMK, MIG, SCYB9 Accession Q07325 Amino Acid Sequence Protein sequence (Q07325, Thr23 Thr125, with C 10*His) TPVVRKGRCSCISTNQGTIHLQSLKDLKQFAPSPSCEKIEIIATLKNGVQTCLNPDSADVKELIKKWEKQVSQKKKQKNGKKHQKKKVLKVRKSQRSRQKKTTGGGGSHHHHHHHHHH Expression System HEK293 Molecular Weight Predicted MW: 13. 4 kDa

Product Specification


Species Human
Synonyms Gamma-interferon-induced monokine, Monokine induced by interferon-gamma (HuMIG; MIG), Small-inducible cytokine B9, CMK, MIG, SCYB9
Accession Q07325
Amino Acid Sequence

Protein sequence (Q07325, Thr23-Thr125, with C-10*His) TPVVRKGRCSCISTNQGTIHLQSLKDLKQFAPSPSCEKIEIIATLKNGVQTCLNPDSADVKELIKKWEKQVSQKKKQKNGKKHQKKKVLKVRKSQRSRQKKTTGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Predicted MW: 13.4 kDa Observed MW: 16, 17, 18 kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Tag with C-10*His
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

Chemokine (C-X-C motif) ligand 9 (CXCL9) is a small cytokine belonging to the CXC chemokine family that is also known as monokine induced by gamma interferon (MIG). The CXCL9 is one of the chemokine which plays role to induce chemotaxis, promote differentiation and multiplication of leukocytes, and cause tissue extravasation. The CXCL9/CXCR3 receptor regulates immune cell migration, differentiation, and activation. Immune reactivity occurs through recruitment of immune cells, such as cytotoxic lymphocytes (CTLs), natural killer (NK) cells, NKT cells, and macrophages. Th1 polarization also activates the immune cells in response to IFN-γ. Tumor-infiltrating lymphocytes are a key for clinical outcomes and prediction of the response to checkpoint inhibitors. In vivo studies suggest the axis plays a tumorigenic role by increasing tumor proliferation and metastasis. CXCL9 predominantly mediates lymphocytic infiltration to the focal sites and suppresses tumor growth. It is closely related to two other CXC chemokines called CXCL10 and CXCL11. CXCL9, CXCL10 and CXCL11 all elicit their chemotactic functions by interacting with the chemokine receptor CXCR3.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 68455990498

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.5 ★★★★★
Based on 12 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
A
Verified Purchase
AlynReads
Port Orchard, US
★★★★★ 4
Arthurian Fae Quest…say less.
Format: Kindle
A fae centered Arthurian tale unlike any I’ve read so far. The author did a great job at descriptive world building, with scenes easily playing out in my minds eye. There was plenty of action, suspense, and even a touch of horror. An enemies to lovers, slow burn romance, a quest, with plot twist and turns aplenty. There was a love triangle, which I’m not usually a fan of but, it played out well in this story line. The FMC, Morgan Pendragon, was so blatantly naïve, yet I typically expect as much in a ‘book one’ of a series, especially one that features a fairly sheltered princess. I was happy to read that in spite of this, she still showed a strong sense of morals, fire, and spine. Now our MMC? Kairos Draven, aka Void’s Edge. Oh, how I’m a sucker for a smoking’ hot grumpy warrior alpha with a witty mouth, and a strong sense of “touch her and die” attitude, so you know who held all my cards. That ending? Just made me swoon all the harder. Now add a battlecat that rivals the size of a horse…and well Ms. Briar Boleyn you have well and truly stolen my heart. I’m excited to see where the story goes from here, and follow along to see more of the characters growth. I went into this story fairly blind, and I think I enjoyed it all the more because of it. Once the story got going, it had me in an absolute chokehold and it was difficult to put down.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 12, 2024
A
Verified Purchase
Ariel
Fort Morgan, US
★★★★★ 3
Not a bad start
Format: Kindle
3 stars Thank you Netgalley and Briar Boleyn for the ARC! A camelot/king Arthur retelling with fae. I was hooked by the idea of this book immediately and was eager to jump into this world. • slow burn • enemies to lovers • who did this to you Morgan Pendragon watched her mother die by her father's hand when she was just eight years old, hiding under the bed. Morgan is believed to have the tainted blood of the fae in her veins and is cast aside so that her fathers illegitimate son, Arthur, can become the king. She's seen his cruel treatment of the fae firsthand, so when he sends her on a journey to find a fae weapon she seizes the opportunity to do more with her life. Along the way, she finds more than she could have imagined. I don't know a whole lot about King Arthur and Camelot but I had a lot of fun with this story! The plot has some similar tropes to popular romantasy books (From blood and ash) but there's enough originality here that it doesn't feel like I'm reading a copy. I liked how the fae were different in appearance than what is typical in most fantasy books I've read. In this book they have blue hair, violet skin and a wide range of other characteristics. I thought that the world building was easy to follow and I could easily immerse myself into this world. After reading the blurb I kept wondering when she was going to go on the journey to find Excalibur and it doesn't happen until around the 45% mark. The story is a bit slow at times but starts to pick up once they begin their journey to find Excalibur. The John Wick style Inn was a fun concept that I enjoyed reading about. There are a lot of similarities to this and FBAA and I would have liked to have it be a little more different, but I'm hoping book two will have the story turn into something of its own. Overall I enjoyed reading this story and I'm looking forward to reading book two especially after that ending.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 27, 2023
D
Verified Purchase
Darcie Reads A Lot
Alexandria, US
★★★★★ 5
Unexpectedly emotional and packed with action!
Format: Kindle
Why do I suddenly want nothing more than a tiny wyvern to snuggle with?! It’s adorable and I absolutely love all of those moments! Wings of Stars was everything I’ve come expect from this powerful author duo. The fact that it’s written by two different people is completely transparent to the reader and they’ve brought us another world and characters that we’re all emotionally connected to and fully invested in! The injustice that we see from Alfemir in the many forms in which it comes is infuriating and makes me desperate for the conclusion of the story so they can all get what’s coming to them! I love all the guys right now, with one exception, and if you’re read it, you know exactly who I’m talking about. Bastian is hilarious - he was the comedic relief through an otherwise quite serious story. My heart bleeds for him and I can’t wait to see how he progresses through the series. Parts of Wings of Stars were unexpectedly emotional and of course I was left with my jaw on the floor at that cliffhanger! Next, please!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on October 18, 2025
J
Verified Purchase
josh portwood
Birmingham, US
★★★★★ 5
Niz !!!
Format: Kindle
First, let me say that I love both of these authors. I have been hooked by both ever since I discovered their writings, and I follow their social media groups closely. This book did not disappoint. Sure, there are several questions that I have, a couple of times I went huh (which I won't get into because I do not want to offer any spoilers) and I hated the cliff hanger lol, but I cannot lie and say I didn't love the book, because I did. The twist on angels was new and fresh, even though that is part of my questions. The beginning and ending were the better parts, the middle was needed but sorta bogged a little. Kieran was confusing but relatable. Niz is BY FAR the best character of the book, love NIZ. For me, Bastian is a close second, always loved the crazy ones. The other men were good, but Steele gets on my nerves and as of right now, IMO, he doesn't belong, but we will see how that goes. I have lots of questions, but this was an excellent start to a new series and I cannot wait for the next book. Highly recommend
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 21, 2024
S
Verified Purchase
shark
Los Angeles, US
★★★★★ 4
fallen destiny? more like destined to fall in love
Format: Kindle
Kieran is an angel, but she doesn't have an affinity. Nothing angers her father more. If she doesn't find an affinity soon she will be cast to earth & have her wings removed. But she has the choice to become a fallen angel, wings turn black, & live her life on edge. Towards the end of the book things start to make sense. Gabe’s nickname for Kieran, Steele’a hatred, Bastian’s belief that Kieran is powerful. This book ended literally during a war? As one of her friends was injured, and admitted a bit secret? Talk about cliff hanger. The next book comes out August 5th.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on July 8, 2024

recommand products