SKU: 68756037074

CD47 Fc Chimera Protein, Mouse

Sale price$243.00 Regular price$270.00
Save 10%

Pay in installments of $67.50 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 30 - Sep 4

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

CD47 Fc Chimera Protein, MouseProduct Specification Species Mouse Synonyms CD47, MER6, IAP, OA3 Accession Q61735 Amino Acid Sequence Gln19 Lys140, with C terminal hIgG1 Fc

Product Specification


Species Mouse
Synonyms CD47, MER6, IAP, OA3
Accession Q61735
Amino Acid Sequence

Gln19-Lys140, with C-terminal hIgG1 Fc QLLFSNVNSIEFTSCNETVVIPCIVRNVEAQSTEEMFVKWKLNKSYIFIYDGNKNSTTTDQNFTSAKISVSDLINGIASLKMDKRDAMVGNYTCEVTELSREGKTVIELKNRTVSWFSPNEKIEGRMDPKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

Expression System HEK293
Molecular Weight 55-70kDa
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag Human Fc Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1、Brown E J. et al. (2001) Integrin-associated protein (CD47) and its ligands. Trends Cell Biol. 11(3): 130-135.

2、Oldenborg P A. (2004) Role of CD47 in erythroid cells and in autoimmunity. Leuk Lymphoma. 45(7): 1319-1327.

3、Kaczorowski D J. et al. (2007) Targeting CD47: NO limit on therapeutic potential. Circ Res. 100(5): 602-603.

Background

CD47, also known as Integrin-associated protein (IAP), is a typical representative of the "marker of self" of targets expressed by all types of cells. CD47 is a glycoprotein with an immunoglobulin variable N-terminal domain, five transmembrane domains, and a short C-terminal intracellular tail with four variably different splicing isomers, resulting in four isoforms. CD47 is an immune cell group that plays a major role in targeted tumor immunotherapy. CD47 expressed by cancer cells interacts with Sirp-α and Sirp-γ expressed by NK cells to protect cancer cells from phagocytosis and elimination. CD47 was highly expressed in a variety of solid tumor cells and malignant hematoma cells, and its expression level was positively correlated with disease progression.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 68756037074

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.9 ★★★★★
Based on 29 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
N
Verified Purchase
Nickolas C
Natrona Heights, US
★★★★★ 5
Mouth rinse that has no alcohol and works like no other I have experienced.
Flavor Name: Mint, Size: 33.8 Fl Oz (Pack of 1)
Biotene Oral Rinse mouthwash was the answer for a pre-rinse mouth wash, even before bed to leave my mouth sweet and moist. Instead of having to drink something or taste something - - - so I won't eat something before bed. It's been a miracle answer for pre-bed and dry mouth during a sleep period and wakening dryer than I want to be. I used to use Biotene "dry mouth spray", now I don't have to because the Oral mouthwash is my go to! enough said!!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 30, 2026
J
Verified Purchase
Jamie Ann
Boise, US
★★★★★ 5
Great for chemo
Flavor Name: Mint, Size: 33.8 Fl Oz (Pack of 1)
I ended up ordering this due to hearing mouth sores occurring during chemo. Using it twice a day to keep from getting the sours and it’s working great.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 17, 2026
H
Verified Purchase
Heather
Bozeman, US
★★★★★ 5
I sleep through the night! My mouth isn't drier than a desert! Happier teeth and mouth!
Flavor Name: Slightly Sweet, Size: 100 Count (Pack of 1), Flavor Name: Slightly Sweet, Size: 100 Count (Pack of 1)
The reason I started looking for a solution to my dry mouth was at a regular dental cleaning they said I had several cavities and it appeared as the cause was dry mouth. They asked about my medications and sure enough 2 of them cause dry mouth as a side effect. One I quit taking but the other is necessary. So I had several fillings and the dentist suggested I look for some over the counter help for dry mouth. I tried some lozenges during the day and they were ok but didn't solve the issue of overnight. I woke up often and drank a lot of water through the night but it didn't help. Finally I ran across XyliMelts and they said you can stick them onto your tooth/gumline and they just melt through the night. Sounded a little strange but I read a ton of reviews and they were very positive. The way they work is they are made of Xylitol which helps your mouth create saliva. Every product I tried has Xylitol in it I believe, and that's probably because it works really well to help stimulate saliva production. The first night I tried them (my main issue is overnight but these can also be used during the day) it took me a few tries to get them stuck on comfortably but it wasn't terribly difficult. I tried the Strawberry Smoothie flavor first and it was just a light pleasant taste. But the best part was I slept through the night! When I woke up, my mouth was not parched! My lips weren't cracked, there wasn't any pain or discomfort from dry skin causing tiny breaks and tears. I was so amazed! I slept about 6 hours that night and they lasted, in the morning I spit out 2 small pieces. I use 2 when I sleep. A huge relief is these are sugar free and ZERO calories 🫶 Everything has calories it seems lol. They also come in a bunch of different flavors. I have found my favorite flavor is Slightly Sweet and it's just as it sounds, a faint sweet taste. So far all the different flavors are very mild, light tastes. Almost barely there but also pleasant. Finding this affordable product has likely saved my dental health. I was beginning to suffer pain from dry mouth. Once the dentist fixed the decay being caused from dry mouth, and I started using this product, I haven't experienced any pain. The best news is the dentist says there are no new issues. I have been using the product for about 5 months now. I use 2 each night unless I happen to fall asleep before I put them in place. I always wake up if I forgot them lol. It's been a huge blessing to get such better rest since I'm not waking up a million times to drink water that never could truly quench the dryness. Cause water doesn't stimulate saliva production but XyliMelts do! They work, they last throughout the night, they haven't caused any side effects or upset my stomach. I couldn't be happier to have found something that will help my teeth stay healthier. I wish I knew the seriousness of dry mouth caused by certain medications sooner, before it caused damage to my teeth. But now it won't happen again and I'm sleeping well because my mouth is moisturized. No more dry as a desert mouth 😶😂 Seriously, this is a fantastic product.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 21, 2026
D
Verified Purchase
Darling Dumpling
Cuba, US
★★★★★ 5
My number one choice for dry mouth. Really works and worth it.
Flavor Name: Slightly Sweet, Size: 100 Count (Pack of 1)
These do work for very dry mouth. My dentist recommended these because l am on a medication that causes dry mouth. I had no idea it could be this uncomfortable ! It gets to the point I cannot spit after brushing my teeth, can’t make the kiss sound to call my dog, even my voice has been affected. It’s the worst. Sometimes though one tab isn’t enough. I use 3 at once at night. One on each side of mouth between my teeth and cheek, sticking them to my cheek and one on the roof of my mouth. If you have trouble with them sticking to your cheek, definitely try the roof of your mouth. The taste is extremely mild. It’s hard to describe but the flavor but it’s not unpleasant in any way. I rather like it. You get more of a very slight gel consistency when they melt which is what you want. They last in my mouth for hours. I haven’t timed it but it’s half a night’s sleep some nights if I’m asleep. During the day they don’t last as long but still a long time. I’ve been trying different products for dry mouth and I do like to mix it up but this is my go to for serious dry symptoms and nighttime. I really like the sticking feature they have. Will continue to buy.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 23, 2026
P
Verified Purchase
Parcae Morford
Lexington, US
★★★★★ 5
Good for dry mouth
Flavor Name: Slightly Sweet, Size: 100 Count (Pack of 1)
These are one of the few things that help with the pain of my Sjogren's dry mouth. They stick securely and safely. They have a mild minty taste with no menthol. They dissolve without grittiness. I highly recommend them.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 23, 2026

recommand products